Go to browser
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionCatalyzes reversible dehydration of CO2 to form bicarbonate
ProductBeta-carbonic anhydrase CanB
CommentsRv3588c, (MTV024.06c), len: 207 aa. CanB, Beta-carbonic anhydrase, proven biochemically (See Suarez Covarrubias et al. 2005) similar to others e.g. Q9CBJ1|ML1919 putative carbonic anhydrase from Mycobacterium leprae (213 aa), FASTA scores: opt: 1160, E(): 3.1e-66, (84.55% identity in 207 aa overlap). Also similar to many e.g. Q9X903|SCH35.03 from Streptomyces coelicolor (207 aa), FASTA scores: opt: 689, E(): 1.6e-36, (53.85% identity in 195 aa overlap); Q9RS89|DR2238 from Deinococcus radiodurans (264 aa), FASTA scores: opt: 451, E(): 2e-21, (39.7% identity in 189 aa overlap); Q39589|beta-CA1 from Chlamydomonas reinhardtii (267 aa) FASTA scores: opt: 419, E(): 2.1e-19, (36.55% identity in 197 aa overlap); etc. Contains PS00704 and PS00705 Prokaryotic-type carbonic anhydrases signature 1 and 2. Belongs to the plant and prokaryotic carbonic anhydrase family.
Functional categoryIntermediary metabolism and respiration
ProteomicsIdentified by mass spectrometry in Triton X-114 extracts of M. tuberculosis H37Rv (See Malen et al., 2010). Identified by mass spectrometry in the membrane protein fraction of M. tuberculosis H37Rv but not the culture filtrate or membrane protein fraction (See de Souza et al., 2011). Translational start site supported by proteomics data (See Kelkar et al., 2011).
MutantNon-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv and CDC1551 strains (see Sassetti et al., 2003 and Lamichhane et al., 2003). Required for growth in C57BL/6J mouse spleen, by transposon site hybridization (TraSH) in H37Rv (See Sassetti and Rubin, 2003). Essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS40298714030494-
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv3588c|canB
MPNTNPVAAWKALKEGNERFVAGRPQHPSQSVDHRAGLAAGQKPTAVIFGCADSRVAAEIIFDQGLGDMFVVRTAGHVIDSAVLGSIEYAVTVLNVPLIVVLGHDSCGAVNAALAAINDGTLPGGYVRDVVERVAPSVLLGRRDGLSRVDEFEQRHVHETVAILMARSSAISERIAGGSLAIVGVTYQLDDGRAVLRDHIGNIGEEV
      
Bibliography