Gene Rv3609c (gchA)
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Involved in the biosynthesis of tetrahydrofolate (at the first step) [catalytic activity: GTP + 2 H(2)O = formate + 2-amino-4-hydroxy-6-(erythro-1,2,3-trihydroxypropyl)dihydropteridine triphosphate]. |
| Product | GTP cyclohydrolase I FolE (GTP-ch-I) |
| Comments | Rv3609c, (MTCY07H7B.13), len: 202 aa. Probable folE (alternate gene name: gchA), GTP cyclohydrolase I, equivalent to O69531|GCH1_MYCLE|FOLE|ML0223|MLCB2548.08c GTP cyclohydrolase I from Mycobacterium leprae (205 aa) FASTA scores: opt: 1112, E(): 3.8e-63, (81.95% identity in 205 aa overlap). Also highly similar to many e.g. Q9X8I3|GCH1_STRCO|FOLE|SCE9.10c from Streptomyces coelicolor (201 aa), FASTA scores: opt: 873, E(): 4.2e-48, (67.4% identity in 187 aa overlap); Q9KCC7|MTRA|BH1646 from Bacillus halodurans (188 aa), FASTA scores: opt: 757, E(): 8.1e-41, (62.3% identity in 183 aa overlap); P19465|GCH1_BACSU|FOLE|MTRA from Bacillus subtilis (190 aa), FASTA scores: opt: 750, E(): 2.3e-40, (58.95% identity in 190 aa overlap); etc. Contains PS00860 GTP cyclohydrolase I signature 2. Belongs to the GTP cyclohydrolase I family. |
| Functional category | Intermediary metabolism and respiration |
| Proteomics | Identified by mass spectrometry in whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate or membrane protein fraction (See de Souza et al., 2011). |
| Mutant | Essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 4049977 | 4050585 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv3609c|folE
MSQLDSRSASARIRVFDQQRAEAAVRELLYAIGEDPDRDGLVATPSRVARSYREMFAGLYTDPDSVLNTMFDEDHDELVLVKEIPMYSTCEHHLVAFHGVAHVGYIPGDDGRVTGLSKIARLVDLYAKRPQVQERLTSQIADALMKKLDPRGVIVVIEAEHLCMAMRGVRKPGSVTTTSAVRGLFKTNAASRAEALDLILRK
Bibliography
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- de Souza GA et al. [2011]. Bacterial proteins with cleaved or uncleaved signal peptides of the general secretory pathway. Proteomics
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant
