Go to browser
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionInvolved in the biosynthesis of tetrahydrofolate (at the first step) [catalytic activity: GTP + 2 H(2)O = formate + 2-amino-4-hydroxy-6-(erythro-1,2,3-trihydroxypropyl)dihydropteridine triphosphate].
ProductGTP cyclohydrolase I FolE (GTP-ch-I)
CommentsRv3609c, (MTCY07H7B.13), len: 202 aa. Probable folE (alternate gene name: gchA), GTP cyclohydrolase I, equivalent to O69531|GCH1_MYCLE|FOLE|ML0223|MLCB2548.08c GTP cyclohydrolase I from Mycobacterium leprae (205 aa) FASTA scores: opt: 1112, E(): 3.8e-63, (81.95% identity in 205 aa overlap). Also highly similar to many e.g. Q9X8I3|GCH1_STRCO|FOLE|SCE9.10c from Streptomyces coelicolor (201 aa), FASTA scores: opt: 873, E(): 4.2e-48, (67.4% identity in 187 aa overlap); Q9KCC7|MTRA|BH1646 from Bacillus halodurans (188 aa), FASTA scores: opt: 757, E(): 8.1e-41, (62.3% identity in 183 aa overlap); P19465|GCH1_BACSU|FOLE|MTRA from Bacillus subtilis (190 aa), FASTA scores: opt: 750, E(): 2.3e-40, (58.95% identity in 190 aa overlap); etc. Contains PS00860 GTP cyclohydrolase I signature 2. Belongs to the GTP cyclohydrolase I family.
Functional categoryIntermediary metabolism and respiration
ProteomicsIdentified by mass spectrometry in whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate or membrane protein fraction (See de Souza et al., 2011).
MutantEssential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS40499774050585-
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv3609c|folE
MSQLDSRSASARIRVFDQQRAEAAVRELLYAIGEDPDRDGLVATPSRVARSYREMFAGLYTDPDSVLNTMFDEDHDELVLVKEIPMYSTCEHHLVAFHGVAHVGYIPGDDGRVTGLSKIARLVDLYAKRPQVQERLTSQIADALMKKLDPRGVIVVIEAEHLCMAMRGVRKPGSVTTTSAVRGLFKTNAASRAEALDLILRK