Go to browser
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionUnknown
ProductProbable conserved integral membrane protein
CommentsRv3629c, (MTCY15C10.23), len: 365 aa. Probable conserved integral membrane protein, equivalent to O69543|MLCB2548.26|ML0205 putative membrane protein from Mycobacterium leprae (356 aa), FASTA scores: opt: 1547, E(): 3e-89, (66.2% identity in 361 aa overlap). Also similar to other membrane and hypothetical proteins e.g. CAC37534|SCIF3.15c putative integral membrane protein from Streptomyces coelicolor (363 aa), FASTA scores: opt: 819, E(): 7.7e-44, (51.55% identity in 351 aa overlap); Q9CGK3|YKJK hypothetical protein from Lactococcus lactis (subsp. lactis) (Streptococcus lactis) (339 aa) FASTA scores: opt: 683, E(): 2.2e-35, (48.3% identity in 350 aa overlap); Q9KY24|SCC8A.24c putative integral membrane protein from Streptomyces coelicolor (380 aa) FASTA scores: opt: 528, E(): 1.1e-25, (50.25% identity in 372 aa overlap); Q9RJH8|SCF73.09 putative integral membrane protein from Streptomyces coelicolor (370 aa) FASTA scores: opt: 439, E(): 3.9e-20, (50.2% identity in 384 aa overlap); Q9PE36|XF1192 integral membrane protein from Xylella fastidiosa (341 aa), FASTA scores: opt: 337, E(): 8.3e-14, (47.65% identity in 361 aa overlap); etc.
Functional categoryCell wall and cell processes
ProteomicsPredicted transmembrane protein - identified in culture filtrates of M. tuberculosis H37Rv; signal peptide predicted (See Malen et al., 2007).
MutantNon-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv and CDC1551 strains (see Sassetti et al., 2003 and Lamichhane et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS40679574069054-
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv3629c|Rv3629c
MSTFRIFGFSLLMTVVALVTGYLHGGPTALFLLAVLALLEVSLSFDNAIINAAILQRMSPFWQRMFLTIGILIAVFGMRLVFPLAIIWTTAGLDPVRAMELALRPPAHGALEFADGSPSYEKLITAAHPQIAAFGGMFLLMLFLDFVVHDRDIKWLKWIEVPFARIGRLGQVPVIVASVGLVLAGALLTHSSDQRGTVLIAGLLGMVTYLVVNGISRAFRPAGLGEATPGVQARQAAGKAGCALFLYLEVLDAAFSFDGVTGAFAITTDPIIIALGLGVVGAMFVRSITIYLVRQDTLDRYVYLEHGAHWAIGALAIILLLSIDHRFAVPEWVTASVGVVFIGAAFTESVRRNRLTVRSPTKFGS