Go to browser
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionPossibly involved in cold acclimation processes (the production of the protein is supposedly predominantly induced at low temperatures).
ProductProbable cold shock protein A CspA
CommentsRv3648c, (MTCY15C10.04), len: 67 aa. Probable cspA, cold shock protein A, identical to O69550|CSPB|CSPA|ML0198 small cold-shock protein from Mycobacterium leprae (67 aa) FASTA scores: opt: 451, E(): 3.7e-27, (97.0% identity in 67 aa overlap). Also highly similar to many e.g. Q9KGW0|CSPA from Mycobacterium smegmatis (67 aa) FASTA scores: opt: 439, E(): 2.9e-26, (92.55% identity in 67 aa overlap); P54584|CSP_ARTGO from Arthrobacter globiformis (67 aa), FASTA scores: opt: 335, E(): 1.5e-18, (73.45% identity in 64 aa overlap); O30875|CSPA_MICLU from Micrococcus luteus (Micrococcus lysodeikticus); Q9Z5R4|CSPA_BORPE from Bordetella pertussis (67 aa) FASTA scores: opt: 294, E(): 1.7e-15, (59.7% identity in 67 aa overlap); etc. Contains 'cold-shock' DNA-binding domain signature (PS00352) at N-terminal end. Belongs to the cold-shock domain (CSD) family.
Functional category-
ProteomicsThe product of this CDS corresponds to spots 5_104 and 5_36 identified in culture supernatant by proteomics at the Max Planck Institute for Infection Biology, Berlin, Germany, and spot 3648c identified in short term culture filtrate and cell wall by proteomics at the Statens Serum Institute (Denmark) (see proteomics citations). Identified in the culture supernatant of M. tuberculosis H37Rv using mass spectrometry (See Mattow et al., 2003). Identified in the cell wall fraction of M. tuberculosis H37Rv using 2DLC/MS (See Mawuenyega et al., 2005). Identified by mass spectrometry in whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate or membrane protein fraction (See de Souza et al., 2011).
TranscriptomicsmRNA identified by Northern blotting analysis; maximal level of transcription at log-phase growth (see Hu et al., 1999).
MutantNon-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS40883284088531-
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv3648c|cspA
MPQGTVKWFNAEKGFGFIAPEDGSADVFVHYTEIQGTGFRTLEENQKVEFEIGHSPKGPQATGVRSL
      
Bibliography