Gene Rv3648c
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Possibly involved in cold acclimation processes (the production of the protein is supposedly predominantly induced at low temperatures). |
| Product | Probable cold shock protein A CspA |
| Comments | Rv3648c, (MTCY15C10.04), len: 67 aa. Probable cspA, cold shock protein A, identical to O69550|CSPB|CSPA|ML0198 small cold-shock protein from Mycobacterium leprae (67 aa) FASTA scores: opt: 451, E(): 3.7e-27, (97.0% identity in 67 aa overlap). Also highly similar to many e.g. Q9KGW0|CSPA from Mycobacterium smegmatis (67 aa) FASTA scores: opt: 439, E(): 2.9e-26, (92.55% identity in 67 aa overlap); P54584|CSP_ARTGO from Arthrobacter globiformis (67 aa), FASTA scores: opt: 335, E(): 1.5e-18, (73.45% identity in 64 aa overlap); O30875|CSPA_MICLU from Micrococcus luteus (Micrococcus lysodeikticus); Q9Z5R4|CSPA_BORPE from Bordetella pertussis (67 aa) FASTA scores: opt: 294, E(): 1.7e-15, (59.7% identity in 67 aa overlap); etc. Contains 'cold-shock' DNA-binding domain signature (PS00352) at N-terminal end. Belongs to the cold-shock domain (CSD) family. |
| Functional category | - |
| Proteomics | The product of this CDS corresponds to spots 5_104 and 5_36 identified in culture supernatant by proteomics at the Max Planck Institute for Infection Biology, Berlin, Germany, and spot 3648c identified in short term culture filtrate and cell wall by proteomics at the Statens Serum Institute (Denmark) (see proteomics citations). Identified in the culture supernatant of M. tuberculosis H37Rv using mass spectrometry (See Mattow et al., 2003). Identified in the cell wall fraction of M. tuberculosis H37Rv using 2DLC/MS (See Mawuenyega et al., 2005). Identified by mass spectrometry in whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate or membrane protein fraction (See de Souza et al., 2011). |
| Transcriptomics | mRNA identified by Northern blotting analysis; maximal level of transcription at log-phase growth (see Hu et al., 1999). |
| Mutant | Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 4088328 | 4088531 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv3648c|cspA
MPQGTVKWFNAEKGFGFIAPEDGSADVFVHYTEIQGTGFRTLEENQKVEFEIGHSPKGPQATGVRSL
Bibliography
- Hu Y et al. [1999]. Regulation of hmp gene transcription in Mycobacterium tuberculosis: effects of oxygen limitation and nitrosative and oxidative stress. Secondary Transcriptome
- Mollenkopf HJ et al. [1999]. A dynamic two-dimensional polyacrylamide gel electrophoresis database: the mycobacterial proteome via Internet. Proteomics
- Jungblut PR, Schaible UE, Mollenkopf HJ, Zimny-Arndt U, Raupach B, Mattow J, Halada P, Lamer S, Hagens K and Kaufmann SH [1999]. Comparative proteome analysis of Mycobacterium tuberculosis and Mycobacterium bovis BCG strains: towards functional genomics of microbial pathogens. Proteomics
- Rosenkrands I, Weldingh K, Jacobsen S, Hansen CV, Florio W, Gianetri I and Andersen P [2000]. Mapping and identification of Mycobacterium tuberculosis proteins by two-dimensional gel electrophoresis, microsequencing and immunodetection. Proteomics
- Rosenkrands I et al. [2000]. Towards the proteome of Mycobacterium tuberculosis. Proteomics
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Mattow J, Schaible UE, Schmidt F, Hagens K, Siejak F, Brestrich G, Haeselbarth G, Muller EC, Jungblut PR and Kaufmann SH [2003]. Comparative proteome analysis of culture supernatant proteins from virulent Mycobacterium tuberculosis H37Rv and attenuated M. bovis BCG Copenhagen. Proteomics
- Mawuenyega KG et al. [2005]. Mycobacterium tuberculosis functional network analysis by global subcellular protein profiling. Proteomics
- de Souza GA et al. [2011]. Bacterial proteins with cleaved or uncleaved signal peptides of the general secretory pathway. Proteomics
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant