Go to browser
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionInvolved in active transport of dipeptide across the membrane (import). Responsible for the translocation of the substrate across the membrane.
ProductProbable dipeptide-transport integral membrane protein ABC transporter DppC
CommentsRv3664c, (MTV025.012c), len: 266 aa. Probable dppC, dipeptide-transport integral membrane protein ABC-transporter (see Braibant et al., 2000), similar to many peptide permeases e.g. Q9F351|SC9E12.04 putative peptide transport system integral membrane from Streptomyces coelicolor (305 aa), FASTA scores: opt: 901, E(): 1.1e-47, (51.15% identity in 262 aa overlap); Q9KFX1|APPC|BH0349 oligopeptide ABC transporter (permease) from Bacillus halodurans (305 aa), FASTA scores: opt: 652, E(): 1.5e-32, (35.55% identity in 270 aa overlap); P94312|DPPC_BACFI dipeptide transport system permease protein from Bacillus firmus (304 aa), FASTA scores: opt: 642, E(): 5.9e-32, (35.75% identity in 263 aa overlap); P24139|OPPC_BACSU|SPO0KC oligopeptide transport system permease protein from Bacillus subtilis (305 aa), FASTA scores: opt: 637, E(): 1.2e-31, (37.4% identity in 262 aa overlap); P26904|DPPC_BACSU|DCIAC dipeptide transport system permease protein from Bacillus subtilis (320 aa), FASTA scores: opt: 621, E(): 1.2e-30, (39.9% identity in 263 aa overlap); etc. Has similarity with integral membrane components of other binding-protein-dependent transport systems. Belongs to the OPPBC subfamily.
Functional categoryCell wall and cell processes
MutantNon-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS41036754104475-
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv3664c|dppC
VIAAALILLILVVAAFPSLFTAADPTYADPSQSMLAPSAAHWFGTDLQGHDIYSRTVYGARASVTVGLGATLAVFVVGGALGALAGFYGSWIDAVVSRVTDVFLGLPLLLAAIVLMQVMHHRTVWTVIAILALFGWPQVARIARGAVLEVRASDYVLAAKALGLNRFQILLRHALPNAVGPVIAVATVALGIFIVTEATLSYLGVGLPTSVVSWGGDINVAQTRLRSGSPILFYPAGALAITVLAFMMMGDALRDALDPASRAWRA