Gene Rv3664c
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Involved in active transport of dipeptide across the membrane (import). Responsible for the translocation of the substrate across the membrane. |
| Product | Probable dipeptide-transport integral membrane protein ABC transporter DppC |
| Comments | Rv3664c, (MTV025.012c), len: 266 aa. Probable dppC, dipeptide-transport integral membrane protein ABC-transporter (see Braibant et al., 2000), similar to many peptide permeases e.g. Q9F351|SC9E12.04 putative peptide transport system integral membrane from Streptomyces coelicolor (305 aa), FASTA scores: opt: 901, E(): 1.1e-47, (51.15% identity in 262 aa overlap); Q9KFX1|APPC|BH0349 oligopeptide ABC transporter (permease) from Bacillus halodurans (305 aa), FASTA scores: opt: 652, E(): 1.5e-32, (35.55% identity in 270 aa overlap); P94312|DPPC_BACFI dipeptide transport system permease protein from Bacillus firmus (304 aa), FASTA scores: opt: 642, E(): 5.9e-32, (35.75% identity in 263 aa overlap); P24139|OPPC_BACSU|SPO0KC oligopeptide transport system permease protein from Bacillus subtilis (305 aa), FASTA scores: opt: 637, E(): 1.2e-31, (37.4% identity in 262 aa overlap); P26904|DPPC_BACSU|DCIAC dipeptide transport system permease protein from Bacillus subtilis (320 aa), FASTA scores: opt: 621, E(): 1.2e-30, (39.9% identity in 263 aa overlap); etc. Has similarity with integral membrane components of other binding-protein-dependent transport systems. Belongs to the OPPBC subfamily. |
| Functional category | Cell wall and cell processes |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 4103675 | 4104475 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv3664c|dppC
VIAAALILLILVVAAFPSLFTAADPTYADPSQSMLAPSAAHWFGTDLQGHDIYSRTVYGARASVTVGLGATLAVFVVGGALGALAGFYGSWIDAVVSRVTDVFLGLPLLLAAIVLMQVMHHRTVWTVIAILALFGWPQVARIARGAVLEVRASDYVLAAKALGLNRFQILLRHALPNAVGPVIAVATVALGIFIVTEATLSYLGVGLPTSVVSWGGDINVAQTRLRSGSPILFYPAGALAITVLAFMMMGDALRDALDPASRAWRA
Bibliography
- Braibant M et al. [2000]. The ATP binding cassette (ABC) transport systems of Mycobacterium tuberculosis. Review Secondary
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant
