Gene Rv3676
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Involved in transcriptional mechanism. |
| Product | Transcriptional regulatory protein Crp (Crp/Fnr-family) |
| Comments | Rv3676, (MTV025.024), len: 224 aa. Crp, transcriptional regulator belonging to crp/fnr family, identical to Q9CB91|ML2302 putative Crp/Fnr-family transcriptional regulator from Mycobacterium leprae (224 aa), FASTA scores: opt: 1408, E(): 8.8e-81, (95.95% identity in 224 aa overlap). Also highly similar to transcriptional regulators AAK58838 from Corynebacterium glutamicum (Brevibacterium flavum) (227 aa), FASTA scores: opt: 1178, E(): 1.9e-66, (79.9% identity in 224 aa overlap); and Q9XA42|SCH17.05 from Streptomyces coelicolor (224 aa), FASTA scores: opt: 869, E(): 3.4e-47, (54.45% identity in 224 aa overlap); and similar to others e.g. Q9RRX0|DR2362 from Deinococcus radiodurans (231 aa) FASTA scores: opt: 344, E(): 1.8e-14, (30.8% identity in 211 aa overlap); P29281|CRP_HAEIN from Haemophilus influenzae (224 aa), FASTA scores: opt: 330, E(): 1.3e-13, (32.25% identity in 189 aa overlap); P03020|CRP_ECOLI|cap|CSM|B3357 from Escherichia coli strain K12 and Shigella flexneri (210 aa), FASTA scores: opt: 323, E(): 3.5e-13, (32.25% identity in 189 aa overlap); etc. Contains helix-turn-helix motif at aa 175-196 (Score 1990, +5.96 SD). Belongs to the Crp/Fnr family of transcriptional regulators. Binds cAMP. |
| Functional category | Regulatory proteins |
| Proteomics | The product of this CDS corresponds to spot 4_12 identified by proteomics at the Max Planck Institute for Infection Biology, Berlin, Germany (See Mattow et al., 2001). Identified in the membrane fraction of M. tuberculosis H37Rv using 1D-SDS-PAGE and uLC-MS/MS (See Gu et al., 2003). Identified in the membrane fraction of M. tuberculosis H37Rv using nanoLC-MS/MS (See Xiong et al., 2005). Identified by mass spectrometry in Triton X-114 extracts of M. tuberculosis H37Rv (See Malen et al., 2010). Identified by mass spectrometry in M. tuberculosis H37Rv-infected guinea pig lungs at 30 days but not 90 days (See Kruh et al., 2010). Identified by mass spectrometry in the membrane protein fraction and whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate (See de Souza et al., 2011). |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). non essential gene by Himar1-based transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). M. tuberculosis H37Rv Rv3676 mutant shows growth defect in vitro and in vivo, in BALB/c bone marrow-derived macrophages, and in BALB/c mouse lungs and spleen (See Rickman et al., 2005). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 4116478 | 4117152 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv3676|crp
VDEILARAGIFQGVEPSAIAALTKQLQPVDFPRGHTVFAEGEPGDRLYIIISGKVKIGRRAPDGRENLLTIMGPSDMFGELSIFDPGPRTSSATTITEVRAVSMDRDALRSWIADRPEISEQLLRVLARRLRRTNNNLADLIFTDVPGRVAKQLLQLAQRFGTQEGGALRVTHDLTQEEIAQLVGASRETVNKALADFAHRGWIRLEGKSVLISDSERLARRAR
Bibliography
- Mattow J, Jungblut PR, Schaible UE, Mollenkopf HJ, Lamer S, Zimny-Arndt U, Hagens K, Muller EC and Kaufmann SH [2001]. Identification of proteins from Mycobacterium tuberculosis missing in attenuated Mycobacterium bovis BCG strains. Proteomics
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Gu S et al. [2003]. Comprehensive proteomic profiling of the membrane constituents of a Mycobacterium tuberculosis strain. Proteomics
- Xiong Y, Chalmers MJ, Gao FP, Cross TA and Marshall AG [2005]. Identification of Mycobacterium tuberculosis H37Rv integral membrane proteins by one-dimensional gel electrophoresis and liquid chromatography electrospray ionization tandem mass spectrometry. Proteomics
- Rickman L, Scott C, Hunt DM, Hutchinson T, Menendez MC, Whalan R, Hinds J, Colston MJ, Green J and Buxton RS [2005]. A member of the cAMP receptor protein family of transcription regulators in Mycobacterium tuberculosis is required for virulence in mice and controls transcription of the rpfA gene coding for a resuscitation promoting factor. Mutant Regulon
- Bai G et al. [2005]. Characterization of Mycobacterium tuberculosis Rv3676 (CRPMt), a cyclic AMP receptor protein-like DNA binding protein. Product
- Akif M et al. [2006]. Crystallization and preliminary X-ray crystallographic studies of Mycobacterium tuberculosis CRP/FNR family transcription regulator. Structure
- Agarwal N et al. [2006]. Regulation of the expression of whiB1 in Mycobacterium tuberculosis: role of cAMP receptor protein. Regulon
- Akhter Y et al. [2007]. Novel biochemical properties of a CRP/FNR family transcription factor from Mycobacterium tuberculosis. Biochemistry
- MÃ¥len H et al. [2010]. Definition of novel cell envelope associated proteins in Triton X-114 extracts of Mycobacterium tuberculosis H37Rv. Proteomics
- Stapleton M et al. [2010]. Mycobacterium tuberculosis cAMP receptor protein (Rv3676) differs from the Escherichia coli paradigm in its cAMP binding and DNA binding properties and transcription activation properties. Biochemistry Regulon
- Kruh NA et al. [2010]. Portrait of a pathogen: the Mycobacterium tuberculosis proteome in vivo. Proteomics
- de Souza GA et al. [2011]. Bacterial proteins with cleaved or uncleaved signal peptides of the general secretory pathway. Proteomics
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant