Gene Rv3695
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Unknown |
| Product | Possible conserved membrane protein |
| Comments | Rv3695, (MTV025.043), len: 310 aa. Possible conserved membrane protein, equivalent, but longer 88 aa, to Q9CB83|ML2312 possible membrane protein from Mycobacterium leprae (196 aa), FASTA scores: opt: 898, E(): 5.2e-36, (71.05% identity in 190 aa overlap). Also highly similar to Q9KZM3|SCE34.02 putative integral membrane protein from Streptomyces coelicolor (318 aa), FASTA scores: opt: 740,E(): 2.4e-28, (43.25% identity in 319 aa overlap); and similar to P72718|SLR0254 hypothetical 30.4 KDA protein from Synechocystis sp. strain PCC 6803 (266 aa), FASTA scores: opt: 287, E(): 6.1e-07, (29.6% identity in 260 aa overlap); Q9HW83|PA4318 hypothetical protein from Pseudomonas aeruginosa (265 aa), FASTA scores: opt: 250, E(): 3.5e-05, (32.0% identity in 203 aa overlap); Q9KEW5|BH0734 hypothetical protein from Bacillus halodurans (266 aa), FASTA scores: opt: 168, E(): 0.0047, (25.95% identity in 231 aa overlap); etc. C-terminal end shows some similarity to proline-rich proteins e.g. Q62106 proline-rich salivary protein (fragment) from Mus musculus (Mouse) (188 aa) (36.1% identity in 97 aa overlap). Equivalent to AAK48164 from Mycobacterium tuberculosis strain CDC1551 (269 aa) but longer 41 aa. |
| Functional category | Cell wall and cell processes |
| Proteomics | Identified by mass spectrometry in Triton X-114 extracts of M. tuberculosis H37Rv (See Malen et al., 2010). Identified by mass spectrometry in M. tuberculosis H37Rv-infected guinea pig lungs at 90 days but not 30 days (See Kruh et al., 2010). Identified by mass spectrometry in the membrane protein fraction and whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate (See de Souza et al., 2011). |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 4137206 | 4138138 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv3695|Rv3695
MSEVVTGDAVVLDVQIAQLPVRAVSAVIDITIIFIGYILGLMLWATALTQFDEALTTAFLIIFTVLALVGYPLVWETATRGRSVGKIVMGLRVVSDDGGPERFRQALFRALASVVEIWMLLGSPAVICSMLSPKAKRVGDVFAGTVVVSERGPRLGPPPVMPPSLAWWASSLQLSGLTAGQAEVARQFLVRAPQLDPALREQMAYRIAGDVVARIAPPPPPGVPPQLVLAAVLAERHRRELLRLRPTLPPAGQAPWAQMAPHRGWPPGLSGATPWSPQQPVIPWPEPDPPPQAAPWPQQAPDGPGFSPPG
Bibliography
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Kruh NA et al. [2010]. Portrait of a pathogen: the Mycobacterium tuberculosis proteome in vivo. Proteomics
- Målen H et al. [2010]. Definition of novel cell envelope associated proteins in Triton X-114 extracts of Mycobacterium tuberculosis H37Rv. Proteomics
- de Souza GA et al. [2011]. Bacterial proteins with cleaved or uncleaved signal peptides of the general secretory pathway. Proteomics
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant
