Gene Rv3699
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Function unknown |
| Product | Conserved protein |
| Comments | Rv3699, (MTV025.047), len: 233 aa. Conserved protein, showing similarity with hypothetical proteins e.g. Q9P3V6|SPAC1348.04 (alias Q9P3E7|SPAC750.03c or Q9P7U5|SPAC977.03) from Schizosaccharomyces pombe (Fission yeast) (145 aa), FASTA scores: opt: 188, E(): 7.5e-05, (31.65% identity in 120 aa overlap); and Q9KB70|BH2058 from Bacillus halodurans (241 aa) FASTA scores: opt: 185, E(): 0.00018, (27.8% identity in 162 aa overlap); Q9XA90|SCF43A.25c putative methyltransferase from Streptomyces coelicolor (215 aa), FASTA scores: opt: 166, E(): 0.0025, (29.95% identity in 147 aa overlap); etc. Also highly similar to O06426|Rv0560c|MTCY25D10.39c hypothetical 25.9 KDA protein from Mycobacterium tuberculosis (241 aa), FASTA scores: opt: 690, E(): 6.5e-36, (53.4% identity in 234 aa overlap); and similar to other hypothetical proteins from Mycobacterium tuberculosis e.g. P71805|Rv1377c|MTCY02B12.11c (212 aa) FASTA scores: opt: 378, E(): 1.5e-16, (35.4% identity in 192 aa overlap); P71972|Rv2675c|MTCY441.44c (250 aa) FASTA scores: opt: 297, E(): 2e-11, (31.1% identity in 193 aa overlap); etc. |
| Functional category | Conserved hypotheticals |
| Proteomics | The product of this CDS corresponds to spot 3_93 identified in culture supernatant by proteomics at the Max Planck Institute for Infection Biology, Berlin, Germany (see citations below). Identified in the culture supernatant of M. tuberculosis H37Rv using mass spectrometry (See Mattow et al., 2003). Identified by mass spectrometry in Triton X-114 extracts of M. tuberculosis H37Rv (See Malen et al., 2010). Identified by mass spectrometry in the membrane protein fraction and whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate (See de Souza et al., 2011). Translational start site supported by proteomics data (See Kelkar et al., 2011). |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 4142044 | 4142745 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv3699|Rv3699
MTDEVMDWDSAYREQGAFEGPPPWNIGEPQPELATLIAAGKVRSDVLDAGCGYAELSLALAADGYTVVGIDLTPTAVAAATKAAEERGLTTASFVQADITEFAAYPAGSAGRFSTVIDSTLFHSLPVDSRDRYLSSVHRAAAPGASYYVLVFAKGAFPAELEVKPNEVDEDELRAAVSKYWKIDEIRPAFIHVNPVTIPPQLAGAPVEFPPYDHDEKGRVKFPAYLLTAHKAG
Bibliography
- Mollenkopf HJ et al. [1999]. A dynamic two-dimensional polyacrylamide gel electrophoresis database: the mycobacterial proteome via Internet. Proteomics
- Jungblut PR, Schaible UE, Mollenkopf HJ, Zimny-Arndt U, Raupach B, Mattow J, Halada P, Lamer S, Hagens K and Kaufmann SH [1999]. Comparative proteome analysis of Mycobacterium tuberculosis and Mycobacterium bovis BCG strains: towards functional genomics of microbial pathogens. Proteomics
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Mattow J, Schaible UE, Schmidt F, Hagens K, Siejak F, Brestrich G, Haeselbarth G, Muller EC, Jungblut PR and Kaufmann SH [2003]. Comparative proteome analysis of culture supernatant proteins from virulent Mycobacterium tuberculosis H37Rv and attenuated M. bovis BCG Copenhagen. Proteomics
- MÃ¥len H et al. [2010]. Definition of novel cell envelope associated proteins in Triton X-114 extracts of Mycobacterium tuberculosis H37Rv. Proteomics
- de Souza GA et al. [2011]. Bacterial proteins with cleaved or uncleaved signal peptides of the general secretory pathway. Proteomics
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- Kelkar DS et al. [2011]. Proteogenomic analysis of Mycobacterium tuberculosis by high resolution mass spectrometry. Proteomics Sequence
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant