Gene Rv3756c
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Thought to be involved in active transport of osmoprotectant (glycine betaine/carnitine/choline/L-proline) across the membrane (import). Responsible for the translocation of the substrate across the membrane. |
| Product | Possible osmoprotectant (glycine betaine/carnitine/choline/L-proline) transport integral membrane protein ABC transporter ProZ |
| Comments | Rv3756c, (MTV025.104c), len: 239 aa. Possible proZ, osmoprotectant transport integral membrane protein ABC transporter (see citation below), similar to osmoprotection proteins (proW, proZ) involved in glycine betaine/L-proline/choline transport, e.g. BAB58609|Q99RI4|OPUCB|SA2236|SAV2447 OPUCB protein (probable glycine betaine/carnitine/choline ABC transporter) from Staphylococcus aureus (211 aa) FASTA scores: opt: 434, E(): 2.5e-18, (36.6% identity in 194 aa overlap); Q45461|OPBB_BACSU|OPUBB|prow choline transport system permease protein (mediate the uptake of choline for synthesis of the osmoprotectant glycine betaine) from Bacillus subtilis (217 aa), FASTA scores: opt: 402, E(): 1.9e-16, (32.0% identity in 203 aa overlap); O34878|OPCB_BACSU|OPUCB glycine betaine/carnitine/choline transport system permease protein from Bacillus subtilis (217 aa), FASTA scores: opt: 385, E(): 1.8e-15, (30.2% identity in 222 aa overlap); P39775|O34657|OPUBD|PROZ|OPBD_BACSU choline transport system permease protein from Bacillus subtilis (226 aa) FASTA scores: opt: 350, E(): 2e-13, (31.75% identity in 208 aa overlap); etc. Could belong to the CYSTW subfamily. |
| Functional category | - |
| Proteomics | Identified by mass spectrometry in Triton X-114 extracts of M. tuberculosis H37Rv (See Malen et al., 2010). Identified by mass spectrometry in the membrane protein fraction of M. tuberculosis H37Rv but not the culture filtrate or membrane protein fraction (See de Souza et al., 2011). |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 4201894 | 4202613 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv3756c|proZ
MNFLQQALSYLLTASNWTGPVGLAVRTCEHLEYTAVAVAASALIAVPVGLLIGHTGRGTLLVVGAVNGLRALPTLGVLLLGVLLFGLGLGPPLVALMLLGIPSLLASTYAGIASVDPLVVDAARAMGMTESQVLLRVEVPNALPLMLGGLRSATLQVVATATVAAYASLGGLGGYLIDGIKERRFHIALVGAMMVAALALTLDGLLALAGWVSVPGTGRMRKLAAVVDKPAAGGGHALR
Bibliography
- Braibant M et al. [2000]. The ATP binding cassette (ABC) transport systems of Mycobacterium tuberculosis. Review Secondary
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- MÃ¥len H et al. [2010]. Definition of novel cell envelope associated proteins in Triton X-114 extracts of Mycobacterium tuberculosis H37Rv. Proteomics
- de Souza GA et al. [2011]. Bacterial proteins with cleaved or uncleaved signal peptides of the general secretory pathway. Proteomics
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant