Gene Rv3757c
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Thought to be involved in active transport of osmoprotectant (glycine betaine/carnitine/choline/L-proline) across the membrane (import). Responsible for the translocation of the substrate across the membrane. |
| Product | Possible osmoprotectant (glycine betaine/carnitine/choline/L-proline) transport integral membrane protein ABC transporter ProW |
| Comments | Rv3757c, (MTV025.105c), len: 229 aa. Possible proW, osmoprotectant transport integral membrane protein ABC transporter (see citation below), similar to osmoprotection proteins (proW, proZ) involved in glycine betaine/L-proline/choline transport, e.g. BAB58607|Q99RI6|OPUCD|SA2234|SAV2445 OPUCD protein (probable glycine betaine/carnitine/choline ABC transporter) from Staphylococcus aureus (231 aa) FASTA scores: opt: 364, E(): 7.1e-15, (30.0% identity in 220 aa overlap); Q45461|OPBB_BACSU|OPUBB|prow choline transport system permease protein (mediate the uptake of choline for synthesis of the osmoprotectant glycine betaine) from Bacillus subtilis (217 aa), FASTA scores: opt: 348, E(): 6.2e-14, (31.05% identity in 206 aa overlap); O34878|OPCB_BACSU|OPUCB glycine betaine/carnitine/choline transport system permease protein from Bacillus subtilis (217 aa), FASTA scores: opt: 343, E(): 1.2e-13, (30.1% identity in 206 aa overlap); O34742|OPCD_BACSU|OPUCD glycine betaine/carnitine/choline transport system permease protein from Bacillus subtilis (229 aa) FASTA scores: opt: 337, E(): 2.9e-13, (31.1% identity in 193 aa overlap); etc. Could belong to the CYSTW subfamily. |
| Functional category | Virulence, detoxification, adaptation |
| Proteomics | Identified by mass spectrometry in M. tuberculosis H37Rv-infected guinea pig lungs at 30 days but not 90 days (See Kruh et al., 2010). |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 4202610 | 4203299 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv3757c|proW
MHYLMTHPGAAWALTVVHLRLSLLPVLIGLMSAVPLGLLVQRAPLLRRLTTATASVIFTIPSLALFVVLPLIIGTRILDEANVIVALAAYTTALLVRAVLEALDAVPAQVHDAATAIGYSRIAQMLKVELPLSIPVLVAGLRVVAVTNIAMVSVGSVIGIGGLGTWFTAGYQTNKSDQIVAGVVAMFLLAIVVDVVINLAGRLATPWERAPRAARRRRQVAAPITGGAR
Bibliography
- Braibant M et al. [2000]. The ATP binding cassette (ABC) transport systems of Mycobacterium tuberculosis. Review Secondary
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Kruh NA et al. [2010]. Portrait of a pathogen: the Mycobacterium tuberculosis proteome in vivo. Proteomics
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant
