Go to browser
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionPrevents the cointegration of foreign DNA before integration into the chromosome.
ProductPossible resolvase
CommentsRv3828c, (MTCY409.02), len: 203 aa. Possible resolvase within IS1537 element, similar to others e.g. Q97X40|SSO1915 first ORF in transposon ISC1913 from Sulfolobus solfataricus (213 aa), FASTA scores: opt: 275, E(): 1.6e-11, (30.6% identity in 196 aa overlap); Q9V1M0|PAB2076 resolvase related protein from Pyrococcus abyssi (212 aa), FASTA scores: opt: 254, E(): 4.2e-10, (29.95% identity in 197 aa overlap); Q9RMU7|ORFA putative transposase (belongs to the MerR family of transcriptional regulators) from Helicobacter pylori (Campylobacter pylori) (217 aa), FASTA scores: opt: 243, E(): 2.3e-09, (31.8% identity in 154 aa overlap); etc. Also highly similar to proteins from Mycobacterium tuberculosis e.g. O33334|Rv2792c|MTV002.57c resolvase (193 aa), FASTA scores: opt: 970, E(): 1.5e-58, (79.25% identity in 193 aa overlap); O07773|Rv0605|MTCY19H5.17c putative resolvase (202 aa), FASTA scores: opt: 964, E(): 4e-58, (76.25% identity in 202 aa overlap); P95116|Rv2979c|MTCY349.08 hypothetical 21.4 KDA protein (194 aa), FASTA scores: opt: 895, E(): 1.8e-53, (74.75% identity in 194 aa overlap); Q10831|YS86_MYCTU|Rv2886c|MT2954|MTCY274.17c hypothetical 31.9 KDA protein (295 aa), FASTA scores: opt: 826, E(): 1.1e-48, (66.2% identity in 204 aa overlap) (similarity only at C-terminus); etc. Contains PS00397 Site-specific recombinases active site. Possible helix-turn-helix motif from aa 11-32, Score 1305 (+3.63 SD).
Functional categoryInsertion seqs and phages
MutantNon-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv and CDC1551 strains (see Sassetti et al., 2003 and Lamichhane et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS43027864303397-
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv3828c|Rv3828c
LSVVCCRNRWMNLAVWAERNGVAWVIAYRWFRAGLLPVPAQRVGRLILVNDPAVEESGRGRTLVYARVSSADQRSDLDRRVARVTAWATSQHLSVDKVVAEGGWALNGHRRKFFALLGDPVVTRIVVEHRDRFCWFGSEYVEAALVAQGRELVVVDLAEVDDDLVGDMTEILTSMCARLYGERAAQNGAKRALAAAVGDAEAA