Gene Rv3840
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Supposedly involved in transcriptional mechanism. |
| Product | Possible transcriptional regulatory protein |
| Comments | Rv3840, (MTCY01A6.29c), len: 137 aa. Possible transcriptional regulator, highly similar in part to PSR proteins (penicillin binding protein repressors) e.g. Q47828|PSR PSR protein from Enterococcus hirae (293 aa) FASTA scores: opt: 221, E(): 2.2e-07, (41.65% identity in 108 aa overlap); O86213|PSRFM PSRFM protein (fragment) from Enterococcus hirae (171 aa), FASTA scores: opt: 202, E(): 2.4e-06, (40.75% identity in 108 aa overlap); Q47865|PSR penicillin binding protein repressor from Enterococcus hirae (148 aa), FASTA scores: opt: 201, E(): 2.5e-06, (51.65% identity in 60 aa overlap); etc. Also highly similar in part to other transcriptional regulators e.g. BAB57524|MSRR peptide methionine sulfoxide reductase regulator from Staphylococcus aureus subsp. aureus Mu50 (327 aa), FASTA scores: opt: 195, E(): 1.2e-05, (36.7% identity in 109 aa overlap); Q99Q02|MSRR|SA1195 peptide methionine sulfoxide reductase regulator from Staphylococcus aureus subsp. aureus N315, and Staphylococcus aureus (327 aa), FASTA scores: opt: 192, E(): 1.9e-05, (36.7% identity in 109 aa overlap); Q9K6Q8|LYTR|BH3670 attenuator for lytabc and LYTR expression from Bacillus halodurans (304 aa), FASTA scores: opt: 171, E(): 0.00041, (34.5% identity in 113 aa overlap); etc. |
| Functional category | Regulatory proteins |
| Transcriptomics | DNA microarrays indicate repression by iron and IdeR|Rv2711 in M. tuberculosis H37Rv (See Rodriguez et al., 2002). |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Disruption of this gene provides a growth advantage for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 4313567 | 4313980 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv3840|Rv3840
LAGCIQRFSHVRCLGPGLASDNPTTLISIPRDSYVPIPGHGRDKINAAFALGGGRLLTQTVELATGLHLDHYAEVGFSEFADLVDAFDPLAGVDLPAGCQTLDGRAALGYVRTRATPRADLEGSDVPVPAAAFETQP
Bibliography
- Rodriguez GM, Voskuil MI, Gold B, Schoolnik GK and Smith I [2002]. ideR, An essential gene in mycobacterium tuberculosis: role of IdeR in iron-dependent gene expression, iron metabolism, and oxidative stress response. Transcriptome
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant
