Go to browser
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionRNaseP catalyzes the removal of the 5'-leader sequence from PRE-tRNA to produce the mature 5'terminus. It can also cleave other RNA substrates such as 4.5S RNA. The protein component plays an auxiliary but essential role in vivo by binding to the 5'-leader sequence and broadening the substrate specificity of the ribozyme [catalytic activity: endonucleolytic cleavage of RNA, removing 5'-extra-nucleotide from tRNA precursor].
ProductRibonuclease P protein component RnpA (RNaseP protein) (RNase P protein) (protein C5)
CommentsRv3923c, (MT4041, MTV028.14c), len: 125 aa. RnpA, ribonuclease P protein component (see citations below), equivalent, but longer ~10 aa, to P46610|RNPA_MYCLE|ML2712 ribonuclease P protein component from Mycobacterium leprae (120 aa), FASTA scores: opt: 456, E(): 3.3e-24, (63.0% identity in 119 aa overlap); and Q9L7L9|RNPA from Mycobacterium paratuberculosis (119 aa), FASTA scores: opt: 426, E(): 3.5e-22, (60.65% identity in 122 aa overlap). Also similar to many e.g. P25817|RNPA_STRBI from Streptomyces bikiniensis (123 aa), FASTA scores: opt: 174, E(): 4.2e-05, (36.8% identity in 125 aa overlap); P25814|RNPA_BACSU from Bacillus subtilis (116 aa) FASTA scores: opt: 168, E(): 0.0001, (26.85% identity in 108 aa overlap); P48206|RNPA_STRCO|STH24.03 from Streptomyces coelicolor (123 aa), FASTA scores: opt: 166, E(): 0.00015, (37.6% identity in 125 aa overlap); etc. Contains PS00648 Bacterial Ribonuclease P protein component signature. Belongs to the RnpA family.
Functional categoryInformation pathways
TranscriptomicsDNA microarrays show increased expression in M. tuberculosis H37Rv in BALB/c mice compared to SCID mice, after 21 days of infection (See Talaat et al., 2004).
MutantNon-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS44104124410789-
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv3923c|rnpA
LIATPGLFAVLRARNRMRRSADFETTVKHGMRTVRSDMVVYWWRGSGGGPRVGLIIAKSVGSAVERHRVARRLRHVAGSIVKELHPSDHVVIRALPSSRHVSSARLEQQLRCGLRRAVELAGSDR