Gene Rv3924c
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Involved in translation mechanism. This protein is one of the early assembly proteins of the 50S ribosomal subunit. |
| Product | 50S ribosomal protein L34 RpmH |
| Comments | Rv3924c, (MTV028.15), len: 47 aa. rpmH, 50s ribosomal protein l34 (see citations below), equivalent to many mycobacterial 50S ribosomal protein L34 e.g. P46386|RL34_MYCLE|RPMH|ML2713 from Mycobacterium leprae (47 aa), FASTA scores: opt: 287, E(): 8.5e-17, (91.5% identity in 47 aa overlap); and Q9L7L8|RL34_MYCPA|RPMH from Mycobacterium paratuberculosis (47 aa), FASTA scores: opt: 281, E(): 2.6e-16, (89.35% identity in 47 aa overlap). Also highly similar to other ribosomal proteins e.g. P27901|RL34_STRCO|RPMH|STH24.02 from Streptomyces coelicolor (45 aa), FASTA scores: opt: 234, E(): 1.4e-12, (79.05% identity in 43 aa overlap); and P05647|RL34_BACSU|RPMH from Bacillus subtilis (44 aa) FASTA scores: opt: 229, E(): 3.7e-12, (72.35% identity in 47 aa overlap); etc. Contains PS00784 Ribosomal protein L34 signature. Belongs to the L34P family of ribosomal proteins. |
| Functional category | Information pathways |
| Transcriptomics | DNA microarrays show higher level of expression in M. tuberculosis H37Rv during Mg2+ starvation (See Walters et al., 2006). |
| Regulon | Predicted to be in the RelA|Rv2583c regulon (See Dahl et al., 2003). |
| Mutant | Essential gene (growth defect) for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). <EXISTING> Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 4410786 | 4410929 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv3924c|rpmH
VTKGKRTFQPNNRRRARVHGFRLRMRTRAGRSIVSSRRRKGRRTLSA
Bibliography
- Salazar L et al. [1996]. Organization of the origins of replication of the chromosomes of Mycobacterium smegmatis, Mycobacterium leprae and Mycobacterium tuberculosis and isolation of a functional origin from M. smegmatis. Sequence
- Qin MH, Madiraju MV and Rajagopalan M [1999]. Characterization of the functional replication origin of Mycobacterium tuberculosis. Sequence
- Madiraju MV et al. [1999]. The dnaA gene region of Mycobacterium avium and the autonomous replication activities of its 5' and 3' flanking regions. Homolog Secondary
- Dahl JL et al. [2003]. The role of RelMtb-mediated adaptation to stationary phase in long-term persistence of Mycobacterium tuberculosis in mice. Regulon
- Walters SB et al. [2006]. The Mycobacterium tuberculosis PhoPR two-component system regulates genes essential for virulence and complex lipid biosynthesis. Transcriptome
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant
