Go to browser
virulence, detoxification, adaptation
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionInvolved in translation mechanism. This protein is one of the early assembly proteins of the 50S ribosomal subunit.
Product50S ribosomal protein L34 RpmH
CommentsRv3924c, (MTV028.15), len: 47 aa. rpmH, 50s ribosomal protein l34 (see citations below), equivalent to many mycobacterial 50S ribosomal protein L34 e.g. P46386|RL34_MYCLE|RPMH|ML2713 from Mycobacterium leprae (47 aa), FASTA scores: opt: 287, E(): 8.5e-17, (91.5% identity in 47 aa overlap); and Q9L7L8|RL34_MYCPA|RPMH from Mycobacterium paratuberculosis (47 aa), FASTA scores: opt: 281, E(): 2.6e-16, (89.35% identity in 47 aa overlap). Also highly similar to other ribosomal proteins e.g. P27901|RL34_STRCO|RPMH|STH24.02 from Streptomyces coelicolor (45 aa), FASTA scores: opt: 234, E(): 1.4e-12, (79.05% identity in 43 aa overlap); and P05647|RL34_BACSU|RPMH from Bacillus subtilis (44 aa) FASTA scores: opt: 229, E(): 3.7e-12, (72.35% identity in 47 aa overlap); etc. Contains PS00784 Ribosomal protein L34 signature. Belongs to the L34P family of ribosomal proteins.
Functional categoryInformation pathways
TranscriptomicsDNA microarrays show higher level of expression in M. tuberculosis H37Rv during Mg2+ starvation (See Walters et al., 2006).
RegulonPredicted to be in the RelA|Rv2583c regulon (See Dahl et al., 2003).
MutantEssential gene (growth defect) for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). <EXISTING>
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS44107864410929-
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv3924c|rpmH
VTKGKRTFQPNNRRRARVHGFRLRMRTRAGRSIVSSRRRKGRRTLSA