Gene mtbc0_003622
in Mycobacterium tuberculosis MTBC0
General annotation
| Type | CDS |
| Function | Unknown |
| Product | type II toxin-antitoxin system VapC family toxin |
| Comments | - |
| Functional category | Virulence, detoxification, adaptation |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 3851987 | 3852397 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis MTBC0|mtbc0_003622|mtbc0_003622
VIYMDTSALTKLLISEPETTELRTWLTAQSGQGEDAATSTLGRVELMRVVARYGQPGQTERARYLLDGLDILPLTEPVIGLAETIGPATLRSLDAIHLAAAAQIKRELTAFVTYDHRLLSGCREVGFVTASPGAVR
Bibliography