Go to browser
virulence, detoxification, adaptation
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionUnknown
ProductPossible toxin VapC47. Contains PIN domain.
CommentsRv3408, (MTCY78.20c), len: 136 aa. Possible vapC47, toxin, part of toxin-antitoxin (TA) operon with Rv3407, contains PIN domain, see Arcus et al. 2005. Similar to others in Mycobacterium tuberculosis strains H37Rv and CDC1551 e.g. O50411|Rv3384c|MTV004.42c (130 aa), FASTA scores: opt: 243, E(): 1.7e-09, (35.1% identity in 131 aa overlap); P95252|Rv1962c|MTCY09F9.02 (135 aa), FASTA scores: opt: 191, E(): 5e-06, (35.5% identity in 138 aa overlap), etc.
Functional categoryVirulence, detoxification, adaptation
ProteomicsIdentified by mass spectrometry in whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate or membrane protein fraction (See de Souza et al., 2011).
MutantDisruption of this gene provides a growth advantage for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv and CDC1551 strains (see Sassetti et al., 2003 and Lamichhane et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS38265483826958+
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv3408|vapC47
VIYMDTSALTKLLISEPETTELRTWLTAQSGQGEDAATSTLGRVESMRVVARYGQPGQTERARYLLDGLDILPLTEPVIGLAETIGPATLRSLDAIHLAAAAQIKRELTAFVTYDHRLLSGCREVGFVTASPGAVR