Gene Mb3442
in Mycobacterium bovis AF2122/97
General annotation
Type | CDS |
Function | Unknown |
Product | possible toxin vapc47. contains pin domain. |
Comments | Mb3442, -, len: 136 aa. Equivalent to Rv3408, len: 136 aa, from Mycobacterium tuberculosis strain H37Rv,(99.3% identity in 136 aa overlap). Hypothetical protein,similar to other hypothetical proteins from M. tuberculosis strains H37Rv and CDC1551 e.g. O50411|Rv3384c|MTV004.42c (130 aa), FASTA scores: opt: 243, E(): 1.7e-09, (35.1% identity in 131 aa overlap); P95252|Rv1962c|MTCY09F9.02 (135 aa), FASTA scores: opt: 191, E(): 5e-06, (35.5% identity in 138 aa overlap), etc. |
Functional category | Virulence, detoxification, adaptation |
Mutant | Check for mutants available at TARGET website |
Coordinates
Type | Start | End | Orientation |
---|---|---|---|
CDS | 3779176 | 3779586 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb3442|vapc47 MIYMDTSALTKLLISEPETTELRTWLTAQSGQGEDAATSTLGRVELMRVVARYGQPGQTERARYLLDGLDILPLTEPVIGLAETIGPATLRSLDAIHLAAAAQIKRELTAFVTYDHRLLSGCREVGFVTASPGAVR
Bibliography
No article yet recorded