Go to browser
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionPPIases accelerate the folding of proteins [catalytic activity: cis-trans isomerization of proline imidic peptide bonds in oligopeptides].
ProductProbable iron-regulated peptidyl-prolyl cis-trans isomerase A PpiA (PPIase A) (rotamase A)
CommentsRv0009, (MTCY10H4.08), len: 182 aa. Probable ppiA (alternate gene name: cfp22), iron-regulated peptidyl-prolyl cis-trans isomerase A. Belongs to the cyclophilin-type PPIase family. Alternative start codon has been suggested.
Functional categoryInformation pathways
ProteomicsThe product of this CDS corresponds to spots 4_74, 4_10, 3_328 and 3_361 identified in culture supernatant by proteomics at the Max Planck Institute for Infection Biology, Berlin, Germany, spots 0009 also identified by the Statens Serum Institute (Denmark), and spot identified in the University of California (USA) (see citations below). Identified in the membrane fraction of M. tuberculosis H37Rv using 1D-SDS-PAGE and uLC-MS/MS (See Gu et al., 2003). Identified in the culture supernatant of M. tuberculosis H37Rv using mass spectrometry (See Mattow et al., 2003). Identified in the cytosol of M. tuberculosis H37Rv using 2DLC/MS (See Mawuenyega et al., 2005). Detected by 2-DE and MS in M. tuberculosis H37Rv purified from phagosomes of infected murine bone marrow macrophages but not in H37Rv broth-cultures (See Mattow et al., 2006). Identified in culture filtrates of M. tuberculosis H37Rv (See Malen et al., 2007). Identified by mass spectrometry in Triton X-114 extracts of M. tuberculosis H37Rv (See Malen et al., 2010). Identified by mass spectrometry in the culture filtrate, membrane protein fraction, and whole cell lysates of M. tuberculosis H37Rv (See de Souza et al., 2011).
TranscriptomicsmRNA identified by DNA microarray analysis: possibly down-regulated by hrcA|Rv2374c (see Stewart et al., 2002), and down-regulated after 96h of starvation (see Betts et al., 2002). DNA microarrays indicate induction by iron and IdeR|Rv2711 in M. tuberculosis H37Rv (See Rodriguez et al., 2002).
MutantNon-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non-essential gene for in vitro growth of H37Rv, but essential for in vitro growth on cholesterol; by sequencing of Himar1-based transposon mutagenesis (See Griffin et al., 2011).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS1246813016+
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv0009|ppiA
MADCDSVTNSPLATATATLHTNRGDIKIALFGNHAPKTVANFVGLAQGTKDYSTQNASGGPSGPFYDGAVFHRVIQGFMIQGGDPTGTGRGGPGYKFADEFHPELQFDKPYLLAMANAGPGTNGSQFFITVGKTPHLNRRHTIFGEVIDAESQRVVEAISKTATDGNDRPTDPVVIESITIS
      
Bibliography