Gene Rv0067c
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Possibly involved in transcriptional mechanism. |
| Product | Possible transcriptional regulatory protein (possibly TetR-family) |
| Comments | Rv0067c, (MTV030.10c), len: 189 aa. Possible transcriptional regulator, highly similar to many. Contains probable helix-turn-helix motif from aa 34 to 55 (Score 1523, +4.37 SD). |
| Functional category | Regulatory proteins |
| Mutant | Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 74629 | 75198 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv0067c|Rv0067c
LAPTDRRVRADAARNRARVLEVAYQTFAADGLSVPVDEIARRAGVGAGTVYRHFPTKEALFQAVIADRMHRIIDKGHALLKSKHPGDALFAFLRSMVLQWGATDRGLVEALAGVGIEISSAAPEAEADFLDLLTDLLRAAQRAGTVRPDVDVLEVKTLLVGCQAMQSYNAELAAKVTDVALDGLRANRK
Bibliography
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant