Go to browser
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionFunction unknown
ProductPE family protein PE5
CommentsRv0285, (MTV035.13), len: 102 aa. PE5, Member of the Mycobacterium tuberculosis PE family (see Brennan & Delogu 2002), similar to others e.g. AL0212|MTV012_37 from Mycobacterium tuberculosis (105 aa), FASTA scores: opt: 497, E(): 2.6e-24, (80.4% identity in 102 aa overlap); Z80108|MTCY21B4.03 from Mycobacterium tuberculosis (102 aa), FASTA scores: opt: 413, E(): 3.7e-19, (66.7% identity in 102 aa overlap); etc. A core mycobacterial gene; conserved in mycobacterial strains (See Marmiesse et al., 2004).
Functional categoryPe/ppe
ProteomicsPredicted secreted protein - identified in culture filtrates of M. tuberculosis H37Rv; signal peptide predicted and cleavable signal sequence confirmed experimentally (See Malen et al., 2007). Identified by mass spectrometry in Triton X-114 extracts of M. tuberculosis H37Rv (See Malen et al., 2010). Identified by mass spectrometry in the culture filtrate and membrane protein fraction of M. tuberculosis H37Rv but not whole cell lysates; enriched in the membrane fraction and predicted N-terminal signal peptide is uncleaved (See de Souza et al., 2011).
TranscriptomicsmRNA identified by microarray analysis and down-regulated after 96h of starvation (see Betts et al., 2002). DNA microarrays indicate repression by iron and IdeR|Rv2711 in M. tuberculosis H37Rv (See Rodriguez et al., 2002).
MutantEssential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS349624349932+
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv0285|PE5
MTLRVVPEGLAAASAAVEALTARLAAAHASAAPVITAVVPPAADPVSLQTAAGFSAQGVEHAVVTAEGVEELGRAGVGVGESGASYLAGDAAAAATYGVVGG
      
Bibliography