Go to browser
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionInvolved in base excision repair. Apurinic-apyrimidinic endonuclease. Supposed to remove the damaged DNA at cytosines and guanines by cleaving at the 3' side of the AP site by a beta-elimination reaction. Possibly exhibites 3'-5'-exonuclease, 3'-phosphomonoesterase, 3'-repair diesterase and ribonuclease H activities [catalytic activity: degradation of double-stranded DNA. It acts progressively in a 3'- to 5'-direction, releasing 5'-phosphomononucleotides].
ProductProbable exodeoxyribonuclease III protein XthA (exonuclease III) (EXO III) (AP endonuclease VI)
CommentsRv0427c, (MTCY22G10.24c), len: 291 aa. Probable xthA (alternate gene name: xth), exodeoxyribonuclease III protein (see citation below), similar to others e.g. EX3_ECOLI|P09030 exodeoxyribonuclease III from Escherichia Coli strain K12 (268 aa), FASTA scores: opt: 360, E(): 1.2e-17, (29.3% identity in 270 aa overlap); etc. Belongs to the AP/EXOA family of DNA repair enzymes.
Functional categoryInformation pathways
ProteomicsIdentified by mass spectrometry in whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate or membrane protein fraction (See de Souza et al., 2011). Translational start site supported by proteomics data (See Kelkar et al., 2011).
MutantNon-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Required for growth in C57BL/6J mouse spleen, by transposon site hybridization (TraSH) in H37Rv (See Sassetti and Rubin, 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS516017516892-
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv0427c|xthA
MPDGTIDGGHPQRPASPRLRSPLLRLATWNVNSIRTRLDRVLDWLGRADVDVLAMQETKCPDGQFPALPLFELGYDVAHVGFDQWNGVAIASRVGLDDVRVGFDGQPSWSGKPEVAATTEARALGATCGGIRVWSLYVPNGRALDDPHYTYKLDWLAALRDTAEGWLRDDPAAPIALMGDWNIAPTDDDVWSTEFFAGCTHVSEPERKAFNAIVDAQFTDVVRPFTPGPGVYTYWDYTQLRFPKKQGMRIDFILGSPALAARVMDAQIVREERKGKAPSDHAPVLVDLHAG