Go to browser
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionInvolved in base excision repair. Endonuclease IV plays a role in DNA repair. It cleaves phosphodiester bonds at apurinic or apyrimidinic sites (AP sites) to produce new 5' ends that are base-free deoxyribose 5-phosphate residues [catalytic activity: endonucleolytic cleavage to 5'-phosphooligonucleotide end-products].
ProductProbable endonuclease IV End (endodeoxyribonuclease IV) (apurinase)
CommentsRv0670, (MTCI376.04c), len: 252 aa. Probable end (alternate gene name: nfo), endonuclease IV (apurinase) (see citation below), equivalent to END_MYCLE|P30770|NFO|ML1889 probable endonuclease IV (apurinase) from Mycobacterium leprae (252 aa), FASTA scores: opt: 1463, E(): 0, (85.6% identity in 250 aa overlap). Also similar to others e.g. Q9S2N2|END4_STRCO|NFO|SC6E10.05 probable endonuclease IV from Streptomyces coelicolor (294 aa); etc. Contains PS00729 AP endonucleases family 2 signatures 1 and 2 (PS00729, and PS00730). Belongs to the AP endonucleases family 2. Cofactor: binds 3 zinc ions. The transcription of this CDS seems negatively regulated by the product of mce2R|Rv0586 (See Santangelo et al., 2009).
Functional categoryInformation pathways
ProteomicsIdentified by mass spectrometry in Triton X-114 extracts of M. tuberculosis H37Rv (See Malen et al., 2010). Identified by mass spectrometry in the membrane protein fraction and whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate (See de Souza et al., 2011). Translational start site supported by proteomics data (See Kelkar et al., 2011).
MutantNon-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv and CDC1551 strains (see Sassetti et al., 2003 and Lamichhane et al., 2003). Required for growth in C57BL/6J mouse spleen, by transposon site hybridization (TraSH) in H37Rv (See Sassetti and Rubin, 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Found to be deleted (partially or completely) in one or more clinical isolates (See Tsolaki et al., 2004).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS769792770550+
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv0670|end
VLIGSHVSPTDPLAAAEAEGADVVQIFLGNPQSWKAPKPRDDAAALKAATLPIYVHAPYLINLASANNRVRIPSRKILQETCAAAADIGAAAVIVHGGHVADDNDIDKGFQRWRKALDRLETEVPVYLENTAGGDHAMARRFDTIARLWDVIGDTGIGFCLDTCHTWAAGEALTDAVDRIKAITGRIDLVHCNDSRDEAGSGRDRHANLGSGQIDPDLLVAAVKAAGAPVICETADQGRKDDIAFLRERTGS
      
Bibliography