Go to browser
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionInvolved in the shikimate pathway. Converts chorismate to prephenate in the biosynthesis of tyrosine and phenylalanine.
ProductChorismate mutase
CommentsRv0948c, (MTCY10D7.26), len: 105 aa. Chorismate mutase, AroQ class (See Prakash et al., 2005; Schneider et al., 2008), equivalent to NP_301237.1|NC_002677 conserved hypothetical protein from Mycobacterium leprae (105 aa). Also similar (except in N-terminus) to SCD63.16c|CAB82023.1|AL161755 hypothetical protein from Streptomyces coelicolor (110 aa); and to N-terminus of two chorismate mutase/prephenate dehydratase.
Functional categoryIntermediary metabolism and respiration
ProteomicsIdentified in the cell membrane fraction of M. tuberculosis H37Rv using 2DLC/MS (See Mawuenyega et al., 2005). Identified by mass spectrometry in whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate or membrane protein fraction (See de Souza et al., 2011). Translational start site supported by proteomics data (See Kelkar et al., 2011).
MutantEssential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS10576461057963-
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv0948c|Rv0948c
MRPEPPHHENAELAAMNLEMLESQPVPEIDTLREEIDRLDAEILALVKRRAEVSKAIGKARMASGGTRLVHSREMKVIERYSELGPDGKDLAILLLRLGRGRLGH
      
Bibliography