Gene Rv1221
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | The sigma factor is an initiation factor that promotes attachment of the RNA polymerase to specific initiation sites and then is released. Seems to be regulated by sigh (Rv3223c product). Seems to regulate the heat-shock response. |
| Product | Alternative RNA polymerase sigma factor SigE |
| Comments | Rv1221, (MTCI61.04), len: 257 aa. SigE, alternative sigma factor of extracytoplasmic function (ECF) family (see citations below). Similar to many e.g. RPOE_HAEIN|P44790 RNA polymerase sigma-e factor from Haemophilus influenzae (189 aa), FASTA scores: opt: 247, E(): 3.4e-06, (28.5% identity in 186 aa overlap); etc. Also similar to MTCY07D11.03 rpoE from Mycobacterium tuberculosis (35.2% identity in 159 aa overlap). Belongs to the sigma-70 factor family, ECF subfamily. Three promoters and three translational start codons have been detected (See Dona et al., 2008). Fourth transcriptional start point has been identified (See Pang et al., 2007). Note that in Mycobacterium bovis BCG, the sigE gene is transcribed from two promoters, P1 and P2, and that these promoters were expressed at temperatures from 30-50 degrees Celsius. |
| Functional category | Information pathways |
| Transcriptomics | mRNA identified by SCOTS method, during infection of cultured human primary macrophages (see Graham & Clark-Curtiss 1999). mRNA also identified by real-time quantitative RT-PCR during exponential growing cultures. mRNA level increased under stress conditions (0.05% SDS) and after heat shock (see Manganelli et al., 1999; Stewart et al., 2002). DNA microarrays and qRT-PCR indicate regulation by MprA under physiological conditions and environmental stress (SDS and Triton X-100) (See He et al., 2006). |
| Mutant | Essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). M. tuberculosis H37Rv sigE|Rv1221 mutant induces high levels of TNF and IL-6 in bone marrow macrophages compared to wild-type (See Fontan et al., 2008). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 1364413 | 1365186 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv1221|sigE
MELLGGPRVGNTESQLCVADGDDLPTYCSANSEDLNITTITTLSPTSMSHPQQVRDDQWVEPSDQLQGTAVFDATGDKATMPSWDELVRQHADRVYRLAYRLSGNQHDAEDLTQETFIRVFRSVQNYQPGTFEGWLHRITTNLFLDMVRRRARIRMEALPEDYDRVPADEPNPEQIYHDARLGPDLQAALASLPPEFRAAVVLCDIEGLSYEEIGATLGVKLGTVRSRIHRGRQALRDYLAAHPEHGECAVHVNPVR
Bibliography
- Wu QL et al. [1997]. A mycobacterial extracytoplasmic function sigma factor involved in survival following stress. Product Biochemistry Mutant
- Gomez JE et al. [1997]. Sigma factors of Mycobacterium tuberculosis. Review
- Manganelli R et al. [1999]. Differential expression of 10 sigma factor genes in Mycobacterium tuberculosis. Transcriptome
- Fernandes ND et al. [1999]. A mycobacterial extracytoplasmic sigma factor involved in survival following heat shock and oxidative stress. Homolog Mutant
- Graham JE and Clark-Curtiss JE [1999]. Identification of Mycobacterium tuberculosis RNAs synthesized in response to phagocytosis by human macrophages by selective capture of transcribed sequences (SCOTS). Transcriptome
- Chen P, Gomez J and Bishai WR [2000]. Review
- Raman S, Song T, Puyang X, Bardarov S, Jacobs Jr WR and Husson RN [2001]. The alternative sigma factor SigH regulates major components of oxidative and heat stress responses in Mycobacterium tuberculosis. Secondary Regulation
- Manganelli R et al. [2001]. The Mycobacterium tuberculosis ECF sigma factor sigmaE: role in global gene expression and survival in macrophages. Mutant
- Jensen-Cain DM et al. [2001]. Differential expression of sigE by Mycobacterium tuberculosis during intracellular growth. Regulation Product
- Stewart GR et al. [2002]. Dissection of the heat-shock response in Mycobacterium tuberculosis using mutants and microarrays. Transcriptome Mutant Regulation
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- He H et al. [2006]. MprAB is a stress-responsive two-component system that directly regulates expression of sigma factors SigB and SigE in Mycobacterium tuberculosis. Regulation Transcriptome
- Pang X et al. [2007]. Evidence for complex interactions of stress-associated regulons in an mprAB deletion mutant of Mycobacterium tuberculosis. Regulon
- Donà V et al. [2008]. Evidence of complex transcriptional, translational, and posttranslational regulation of the extracytoplasmic function sigma factor sigmaE in Mycobacterium tuberculosis. Regulation
- Fontán PA et al. [2008]. Mycobacterium tuberculosis sigma factor E regulon modulates the host inflammatory response. Mutant
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant
