Go to browser
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionThe sigma factor is an initiation factor that promotes attachment of the RNA polymerase to specific initiation sites and then is released. Seems to be regulated by sigh (Rv3223c product). Seems to regulate the heat-shock response.
ProductAlternative RNA polymerase sigma factor SigE
CommentsRv1221, (MTCI61.04), len: 257 aa. SigE, alternative sigma factor of extracytoplasmic function (ECF) family (see citations below). Similar to many e.g. RPOE_HAEIN|P44790 RNA polymerase sigma-e factor from Haemophilus influenzae (189 aa), FASTA scores: opt: 247, E(): 3.4e-06, (28.5% identity in 186 aa overlap); etc. Also similar to MTCY07D11.03 rpoE from Mycobacterium tuberculosis (35.2% identity in 159 aa overlap). Belongs to the sigma-70 factor family, ECF subfamily. Three promoters and three translational start codons have been detected (See Dona et al., 2008). Fourth transcriptional start point has been identified (See Pang et al., 2007). Note that in Mycobacterium bovis BCG, the sigE gene is transcribed from two promoters, P1 and P2, and that these promoters were expressed at temperatures from 30-50 degrees Celsius.
Functional categoryInformation pathways
TranscriptomicsmRNA identified by SCOTS method, during infection of cultured human primary macrophages (see Graham & Clark-Curtiss 1999). mRNA also identified by real-time quantitative RT-PCR during exponential growing cultures. mRNA level increased under stress conditions (0.05% SDS) and after heat shock (see Manganelli et al., 1999; Stewart et al., 2002). DNA microarrays and qRT-PCR indicate regulation by MprA under physiological conditions and environmental stress (SDS and Triton X-100) (See He et al., 2006).
MutantEssential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). M. tuberculosis H37Rv sigE|Rv1221 mutant induces high levels of TNF and IL-6 in bone marrow macrophages compared to wild-type (See Fontan et al., 2008).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS13644131365186+
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv1221|sigE
MELLGGPRVGNTESQLCVADGDDLPTYCSANSEDLNITTITTLSPTSMSHPQQVRDDQWVEPSDQLQGTAVFDATGDKATMPSWDELVRQHADRVYRLAYRLSGNQHDAEDLTQETFIRVFRSVQNYQPGTFEGWLHRITTNLFLDMVRRRARIRMEALPEDYDRVPADEPNPEQIYHDARLGPDLQAALASLPPEFRAAVVLCDIEGLSYEEIGATLGVKLGTVRSRIHRGRQALRDYLAAHPEHGECAVHVNPVR
      
Bibliography