Go to browser
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionThis protein specifically catalyzes the removal of signal peptides from prolipoproteins [catalytic activity: cleavage of N-terminal leader sequences from membrane prolipoproteins. Hydrolyses XAA-XBB-XBB-|-CYS, in which XAA is hydrophobic (preferably LEU), XBB is often SER or ala, XCC is often GLY or ala, and the CYS is alkylated on sulfur with a diacylglyceryl group].
ProductProbable lipoprotein signal peptidase LspA
CommentsRv1539, (MTCY48.26c), len: 202 aa. Probable lspA, lipoprotein signal peptidase (see citation below), similar to several e.g. LSPA_PSEFL|P17942 (170 aa), FASTA scores: opt: 299, E(): 2.6e-12, (38.3% identity in 167 aa overlap). Conserved in M. tuberculosis, M. leprae, M. bovis and M. avium paratuberculosis; predicted to be essential for in vivo survival and pathogenicity (See Ribeiro-Guimaraes and Pessolani, 2007).
Functional categoryCell wall and cell processes
ProteomicsTranslational start site supported by proteomics data (See Kelkar et al., 2011).
MutantNon-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Disruption of this gene results in growth defect of H37Rv in vitro, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS17422441742852+
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv1539|lspA
VPDEPTGSADPLTSTEEAGGAGEPNAPAPPRRLRMLLSVAVVVLTLDIVTKVVAVQLLPPGQPVSIIGDTVTWTLVRNSGAAFSMATGYTWVLTLIATGVVVGIFWMGRRLVSPWWALGLGMILGGAMGNLVDRFFRAPGPLRGHVVDFLSVGWWPVFNVADPSVVGGAILLVILSIFGFDFDTVGRRHADGDTVGRRKADG