Go to browser
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionUnknown
ProductPossible Inv protein
CommentsRv1566c, (MTCY336.37), len: 230 aa. Possible inv protein, probably exported as has QQAPV repeats at C-terminus. Similar to Q49634 inv protein from Mycobacterium leprae (246 aa), FASTA scores: opt: 957, E(): 0, (70.0% identity in 207 aa overlap); also to putative invasins 1,2 (O07390, O07391) from Mycobacterium avium. Slightly similar to C-terminus of P60_LISMO|P21171 Listeria invasion-associated protein p60 precursor. Also similar to Mycobacterium tuberculosis p60 homologues Rv1477, Rv1478, Rv0024, Rv2190c. Predicted to be an outer membrane protein (See Song et al., 2008).
Functional category-
ProteomicsIdentified by mass spectrometry in Triton X-114 extracts of M. tuberculosis H37Rv (See Malen et al., 2010). Identified by mass spectrometry in the membrane protein fraction and whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate (See de Souza et al., 2011).
MutantNon-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Disruption of this gene provides a growth advantage for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS17739281774620-
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv1566c|Rv1566c
MKRSMKSGSFAIGLAMMLAPMVAAPGLAAADPATRPVDYQQITDVVIARGLSQRGVPFSWAGGGISGPTRGTGTGINTVGFDASGLIQYAYAGAGLKLPRSSGQMYKVGQKVLPQQARKGDLIFYGPEGTQSVALYLGKGQMLEVGDVVQVSPVRTNGMTPYLVRVLGTQPTPVQQAPVQPAPVQQAPVQQAPVQQAPVQQAPVQQAPVQQAPVQQAPVQPPPFGTARSR