Go to browser
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionInvolved in the transcription termination process. Interacts with RPSJ|NUSE|Rv0700.
ProductN utilization substance protein NusB (NusB protein)
CommentsRv2533c, (MT2608, MTCY159.23), len: 156 aa. NusB, N utilization substance protein (see citations below), equivalent to Q9CCR9|NUSB_MYCLE|ML0523 N utilization substance protein B from Mycobacterium leprae (190 aa), FASTA scores: opt: 749, E(): 2.6e-41, (75.7% identity in 148 aa overlap). Also highly similar to others e.g. Q9KXR0|SC9C5.14 from Streptomyces coelicolor (142 aa), FASTA scores: opt: 358, E(): 2.7e-16, (45.0% identity in 140 aa overlap); P54520|NUSB_BACSU from Bacillus subtilis (131 aa), FASTA scores: opt: 315, E(): 1.5e-13, (39.55% identity in 129 aa overlap); O83979|NUSB_TREPA|TP1015 from Treponema pallidum (141 aa), FASTA scores: opt: 268, E(): 1.6e-10, (36.95% identity in 138 aa overlap); etc. Belongs to the NusB family.
Functional categoryInformation pathways
ProteomicsIdentified by mass spectrometry in whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate or membrane protein fraction (See de Souza et al., 2011).
MutantEssential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS28582542858724-
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv2533c|nusB
MSDRKPVRGRHQARKRAVALLFEAEVRGISAAEVVDTRAALAEAKPDIARLHPYTAAVARGVSEHAAHIDDLITAHLRGWTLDRLPAVDRAILRVSVWELLHAADVPEPVVVDEAVQLAKELSTDDSPGFVNGVLGQVMLVTPQLRAAAQAVRGGA