Gene Rv2539c
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Involved at the fifth step in the biosynthesis of chorismate within the biosynthesis of aromatic amino acids (the shikimate pathway) [catalytic activity: ATP + shikimate = ADP + shikimate 3-phosphate]. |
| Product | Shikimate kinase AroK (SK) |
| Comments | Rv2539c, (MTCY159.17), len: 176 aa. AroK, shikimate kinase (see citations below), equivalent to Q9CCS5|AROK|ML0517 putative shikimate kinase from Mycobacterium leprae (199 aa), FASTA scores: opt: 852, E(): 1.3e-42, (79.65% identity in 167 aa overlap). Also highly similar to many e.g. Q9X5D1|AROK_CORG from Corynebacterium glutamicum (Brevibacterium flavum) (169 aa), FASTA scores: opt: 478, E(): 5.4e-21, (47.0% identity in 168 aa overlap); Q9KXQ5|AROK from Streptomyces coelicolor (171 aa), FASTA scores: opt: 465, E(): 3.1e-20, (49.1% identity in 167 aa overlap); P24167|AROK_ECOLI from Escherichia coli strain K12 (172 aa), FASTA scores: opt: 316, E(): 1.3e-11, (38.4% identity in 164 aa overlap); etc. Contains PS00017 ATP/GTP-binding site motif A, and PS01128 Shikimate kinase signature. Belongs to the shikimate kinase family. |
| Functional category | Intermediary metabolism and respiration |
| Mutant | Essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 2862673 | 2863203 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv2539c|aroK
MAPKAVLVGLPGSGKSTIGRRLAKALGVGLLDTDVAIEQRTGRSIADIFATDGEQEFRRIEEDVVRAALADHDGVLSLGGGAVTSPGVRAALAGHTVVYLEISAAEGVRRTGGNTVRPLLAGPDRAEKYRALMAKRAPLYRRVATMRVDTNRRNPGAVVRHILSRLQVPSPSEAAT
Bibliography
- Parish T, Gordhan BG, McAdam RA, Duncan K, Mizrahi V and Stoker NG [1999]. Production of mutants in amino acid biosynthesis genes of Mycobacterium tuberculosis by homologous recombination. Mutant
- Oliveira JS et al. [2001]. Cloning and overexpression in soluble form of functional shikimate kinase and 5-enolpyruvylshikimate 3-phosphate synthase enzymes from Mycobacterium tuberculosis. Product Biochemistry
- Gu Y et al. [2001]. Crystallization and preliminary X-ray diffraction analysis of shikimate kinase from Mycobacterium tuberculosis in complex with MgADP. Product Structure
- Gu Y et al. [2002]. Crystal structure of shikimate kinase from Mycobacterium tuberculosis reveals the dynamic role of the LID domain in catalysis. Structure
- Filgueira de Azevedo W et al. [2002]. Molecular model of shikimate kinase from Mycobacterium tuberculosis. Structure
- Parish T et al. [2002]. The common aromatic amino acid biosynthesis pathway is essential in Mycobacterium tuberculosis. Mutant
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Pereira JH et al. [2004]. Structure of shikimate kinase from Mycobacterium tuberculosis reveals the binding of shikimic acid. Structure
- Dhaliwal B et al. [2004]. Crystallographic studies of shikimate binding and induced conformational changes in Mycobacterium tuberculosis shikimate kinase. Structure
- Hartmann MD et al. [2006]. Mechanism of phosphoryl transfer catalyzed by shikimate kinase from Mycobacterium tuberculosis. Structure
- Gan J et al. [2006]. Crystal structure of Mycobacterium tuberculosis shikimate kinase in complex with shikimic acid and an ATP analogue. Structure
- Dias MV et al. [2007]. Effects of the magnesium and chloride ions and shikimate on the structure of shikimate kinase from Mycobacterium tuberculosis. Structure
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant