Gene Rv2593c
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | forms a complex with RUVB. RUVA stimulates, in the presence of DNA, the weak ATPase activity of RUVB. The RUVA-RUVB complex in the presence of ATP renatures cruciform structure in supercoiled DNA with palindromic sequence, indicating that it may promote strand exchange reactions in homologous recombination. RUVAB is an helicase that mediates the holliday junction migration by localized denaturation and reanneling. |
| Product | Probable holliday junction DNA helicase RuvA |
| Comments | Rv2593c, (MTCY227.08), len: 196 aa. Probable ruvA, Holliday junction binding protein (see citations below), equivalent to P40832|RUVA_MYCLE|ML0482|B1177_C2_188 holliday junction DNA helicase from Mycobacterium leprae (203 aa), FASTA scores: opt: 923, E(): 9.9e-50, (76.85% identity in 203 aa overlap). Also highly similar to others e.g. Q9L290|RUVA from Streptomyces coelicolor (201 aa) (201 aa), FASTA scores: opt: 549, E(): 8.2e-27, (47.55% identity in 204 aa overlap); Q9AE10|RUVA from Corynebacterium glutamicum (Brevibacterium flavum) (206 aa), FASTA scores: opt: 440, E(): 4e-20, (47.1% identity in 206 aa overlap); P08576|RUVA_ECOLI|B1861|Z2913|ECS2571 from Escherichia coli strains K12 and O157:H7 (203 aa), FASTA scores: opt: 312, E(): 2.8e-12, (34.85% identity in 201 aa overlap); etc. Belongs to the RuvA family. |
| Functional category | Information pathways |
| Proteomics | Identified in the membrane fraction of M. tuberculosis H37Rv using 1D-SDS-PAGE and uLC-MS/MS (See Gu et al., 2003). |
| Transcriptomics | mRNA identified by microarray analysis and down-regulated after 24h of starvation (see Betts et al., 2002). |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Disruption of this gene results in growth defect of H37Rv in vitro, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 2924230 | 2924820 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv2593c|ruvA
MIASVRGEVLEVALDHVVIEAAGVGYRVNATPATLATLRQGTEARLITAMIVREDSMTLYGFPDGETRDLFLTLLSVSGVGPRLAMAALAVHDAPALRQVLADGNVAALTRVPGIGKRGAERMVLELRDKVGVAATGGALSTNGHAVRSPVVEALVGLGFAAKQAEEATDTVLAANHDATTSSALRSALSLLGKAR
Bibliography
- Mizrahi V et al. [1998]. DNA repair in Mycobacterium tuberculosis. What have we learnt from the genome sequence? Secondary Function
- Brooks PC, Movahedzadeh F and Davis EO [2001]. Identification of some DNA damage-inducible genes of Mycobacterium tuberculosis: apparent lack of correlation with LexA binding. Function
- Betts JC et al. [2002]. Evaluation of a nutrient starvation model of Mycobacterium tuberculosis persistence by gene and protein expression profiling. Transcriptome
- Gu S et al. [2003]. Comprehensive proteomic profiling of the membrane constituents of a Mycobacterium tuberculosis strain. Proteomics
- Prabu JR et al. [2006]. Structure of Mycobacterium tuberculosis RuvA, a protein involved in recombination. Structure
- Prabu JR et al. [2009]. Crystallographic and modelling studies on Mycobacterium tuberculosis RuvA Additional role of RuvB-binding domain and inter species variability. Structure
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant
