Go to browser
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionNuclease that resolves holliday junction intermediates in genetic recombination. Cleaves the cruciform structure in supercoiled DNA by nicking to strands with the same polarity at sites symmetrically opposed at the junction in the homologous ARMS and leaves a 5'terminal phosphate and a 3'terminal hydroxyl group [catalytic activity: endonucleolytic cleavage at a junction such as a reciprocal single-stranded crossover between two homologous DNA duplexes (holliday junction)].
ProductProbable crossover junction endodeoxyribonuclease RuvC (holliday junction nuclease) (holliday junction resolvase)
CommentsRv2594c, (MTCY227.07), len: 188 aa. Probable ruvC, Holliday junction resolvase (see citations below), equivalent to P40834|RUVC_MYCLE|ML0481|B1177_C3_226 crossover junction endodeoxyribonuclease from Mycobacterium leprae (188 aa), FASTA scores: opt: 984, E(): 2.3e-55, (81.0% identity in 184 aa overlap). Also highly similar to others e.g. Q9AE11|RUVC from Corynebacterium glutamicum (Brevibacterium flavum) (221 aa), FASTA scores: opt: 713, E(): 3.6e-38, (56.9% identity in 188 aa overlap); Q9L289|RUVC_STRCO|SCL2.10c from Streptomyces coelicolor (188 aa), FASTA scores: opt: 704, E(): 1.2e-37, (60.65% identity in 178 aa overlap); P24239|RUVC_ECOLI|B1863 from Escherichia coli strain K12 (172 aa), FASTA scores: opt: 322, E(): 1.6e-13, (38.65% identity in 163 aa overlap); etc. Belongs to the RUVC family. Cofactor: magnesium.
Functional categoryInformation pathways
TranscriptomicsmRNA identified by microarray analysis and down-regulated after 24h and 96h of starvation (see citations below).
MutantEssential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019).Disruption of this gene results in growth defect of H37Rv in vitro, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS29248172925383-
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv2594c|ruvC
VRVMGVDPGLTRCGLSLIESGRGRQLTALDVDVVRTPSDAALAQRLLAISDAVEHWLDTHHPEVVAIERVFSQLNVTTVMGTAQAGGVIALAAAKRGVDVHFHTPSEVKAAVTGNGSADKAQVTAMVTKILALQAKPTPADAADALALAICHCWRAPTIARMAEATSRAEARAAQQRHAYLAKLKAAR