Gene Rv2594c
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Nuclease that resolves holliday junction intermediates in genetic recombination. Cleaves the cruciform structure in supercoiled DNA by nicking to strands with the same polarity at sites symmetrically opposed at the junction in the homologous ARMS and leaves a 5'terminal phosphate and a 3'terminal hydroxyl group [catalytic activity: endonucleolytic cleavage at a junction such as a reciprocal single-stranded crossover between two homologous DNA duplexes (holliday junction)]. |
| Product | Probable crossover junction endodeoxyribonuclease RuvC (holliday junction nuclease) (holliday junction resolvase) |
| Comments | Rv2594c, (MTCY227.07), len: 188 aa. Probable ruvC, Holliday junction resolvase (see citations below), equivalent to P40834|RUVC_MYCLE|ML0481|B1177_C3_226 crossover junction endodeoxyribonuclease from Mycobacterium leprae (188 aa), FASTA scores: opt: 984, E(): 2.3e-55, (81.0% identity in 184 aa overlap). Also highly similar to others e.g. Q9AE11|RUVC from Corynebacterium glutamicum (Brevibacterium flavum) (221 aa), FASTA scores: opt: 713, E(): 3.6e-38, (56.9% identity in 188 aa overlap); Q9L289|RUVC_STRCO|SCL2.10c from Streptomyces coelicolor (188 aa), FASTA scores: opt: 704, E(): 1.2e-37, (60.65% identity in 178 aa overlap); P24239|RUVC_ECOLI|B1863 from Escherichia coli strain K12 (172 aa), FASTA scores: opt: 322, E(): 1.6e-13, (38.65% identity in 163 aa overlap); etc. Belongs to the RUVC family. Cofactor: magnesium. |
| Functional category | Information pathways |
| Transcriptomics | mRNA identified by microarray analysis and down-regulated after 24h and 96h of starvation (see citations below). |
| Mutant | Essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019).Disruption of this gene results in growth defect of H37Rv in vitro, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 2924817 | 2925383 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv2594c|ruvC
VRVMGVDPGLTRCGLSLIESGRGRQLTALDVDVVRTPSDAALAQRLLAISDAVEHWLDTHHPEVVAIERVFSQLNVTTVMGTAQAGGVIALAAAKRGVDVHFHTPSEVKAAVTGNGSADKAQVTAMVTKILALQAKPTPADAADALALAICHCWRAPTIARMAEATSRAEARAAQQRHAYLAKLKAAR
Bibliography
- Mizrahi V et al. [1998]. DNA repair in Mycobacterium tuberculosis. What have we learnt from the genome sequence? Secondary Function
- Brooks PC, Movahedzadeh F and Davis EO [2001]. Identification of some DNA damage-inducible genes of Mycobacterium tuberculosis: apparent lack of correlation with LexA binding. Function
- Davis EO et al. [2002]. Definition of the mycobacterial SOS box and use to identify LexA-regulated genes in Mycobacterium tuberculosis. Sequence Regulation Transcriptome
- Betts JC et al. [2002]. Evaluation of a nutrient starvation model of Mycobacterium tuberculosis persistence by gene and protein expression profiling. Transcriptome
- Parish T, Smith DA, Roberts G, Betts J and Stoker NG [2003]. The senX3-regX3 two-component regulatory system of Mycobacterium tuberculosis is required for virulence. Regulation
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant
