Gene Rv2711 (dtxR)
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Transcriptional regulatory protein (repressor and activator), iron-binding repressor of siderophore biosynthesis and iron uptake. Seems to regulate a variety of genes encoding a variety of proteins e.g. transporters, proteins involved in siderophore synthesis and iron storage, members of the PE/PPE family, enzymes involved in lipid metabolism, transcriptional regulatory proteins, etc. Also activator of BFRA|Rv1876 gene. |
| Product | Iron-dependent repressor and activator IdeR |
| Comments | Rv2711, (MTCY05A6.32), len: 230 aa. IdeR (formerly known as dtxR), iron dependent repressor and activator (see citations below), equivalent to Q9CCB5|ML1013 iron dependent repressor from Mycobacterium leprae (230 aa), FASTA scores: opt: 1365, E(): 3.8e-77, (90.0% identity in 230 aa overlap). Also highly similar to others e.g. Q50379|DTXR from Mycobacterium smegmatis (233 aa), FASTA scores: opt: 1291, E(): 1.4e-72, (86.1% identity in 230 aa overlap); Q9F7T3|IDER from Corynebacterium equii (Rhodococcus equi) (230 aa), FASTA scores: opt: 1130, E(): 1.2e-62, (74.8% identity in 230 aa overlap); P33120|DTXR_CORDI from Corynebacterium diphtheriae (226 aa), FASTA scores: opt: 803, E(): 1.6e-42, (57.85% identity in 230 aa overlap); etc. Belongs to the fur family. |
| Functional category | Regulatory proteins |
| Proteomics | Identified in the membrane fraction of M. tuberculosis H37Rv using 1D-SDS-PAGE and uLC-MS/MS (See Gu et al., 2003). Identified in the culture supernatant of M. tuberculosis H37Rv using mass spectrometry (See Mattow et al., 2003). Identified by mass spectrometry in Triton X-114 extracts of M. tuberculosis H37Rv (See Malen et al., 2010). Identified by mass spectrometry in the membrane protein fraction and whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate (See de Souza et al., 2011). Translational start site supported by proteomics data (See de Souza et al., 2011) (See Kelkar et al., 2011). |
| Transcriptomics | mRNA level (identified by real-time quantitative RT-PCR) increased 24h after infection of cultured human macrophages (see Hobson et al., 2002). This upregulation could be a consequence of iron deprivation. mRNA also identified by DNA microarray analysis and up-regulated at high temperatures (see Stewart et al., 2002). |
| Mutant | Essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Essential gene, determined by allelic exchange experiments (See Rodriguez et al., 2002). Essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 3023565 | 3024257 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv2711|ideR
MNELVDTTEMYLRTIYDLEEEGVTPLRARIAERLDQSGPTVSQTVSRMERDGLLRVAGDRHLELTEKGRALAIAVMRKHRLAERLLVDVIGLPWEEVHAEACRWEHVMSEDVERRLVKVLNNPTTSPFGNPIPGLVELGVGPEPGADDANLVRLTELPAGSPVAVVVRQLTEHVQGDIDLITRLKDAGVVPNARVTVETTPGGGVTIVIPGHENVTLPHEMAHAVKVEKV
Bibliography
- Doukhan L et al. [1995]. Genomic organization of the mycobacterial sigma gene cluster. Sequence
- Dussurget O et al. [1996]. An ideR mutant of Mycobacterium smegmatis has derepressed siderophore production and an altered oxidative-stress response. Homolog Mutant
- Dussurget O et al. [1998]. Protective role of the Mycobacterium smegmatis IdeR against reactive oxygen species and isoniazid toxicity. Homolog Mutant
- Rodriguez GM et al. [1999]. Identification and characterization of two divergently transcribed iron regulated genes in Mycobacterium tuberculosis. Secondary Regulation
- Pohl E et al. [1999]. Crystal structure of the iron-dependent regulator (IdeR) from Mycobacterium tuberculosis shows both metal binding sites fully occupied. Structure
- Gold B et al. [2001]. The Mycobacterium tuberculosis IdeR is a dual functional regulator that controls transcription of genes involved in iron acquisition, iron storage and survival in macrophages. Regulation
- Feese MD et al. [2001]. Crystal structure of the iron-dependent regulator from Mycobacterium tuberculosis at 2.0-A resolution reveals the Src homology domain 3-like fold and metal binding function of the third domain. Product Structure
- Rodriguez GM, Voskuil MI, Gold B, Schoolnik GK and Smith I [2002]. ideR, An essential gene in mycobacterium tuberculosis: role of IdeR in iron-dependent gene expression, iron metabolism, and oxidative stress response. Mutant Regulation
- Hobson RJ, Brennan MJ, McBride AJ, Delogu G, Kempsell KE and Dale JW [2002]. Use of an arrayed promoter-probe library for the identification of macrophage-regulated genes in Mycobacterium tuberculosis. Transcriptome Regulation
- Stewart GR et al. [2002]. Dissection of the heat-shock response in Mycobacterium tuberculosis using mutants and microarrays. Transcriptome Mutant Regulation
- Gu S et al. [2003]. Comprehensive proteomic profiling of the membrane constituents of a Mycobacterium tuberculosis strain. Proteomics
- Mattow J, Schaible UE, Schmidt F, Hagens K, Siejak F, Brestrich G, Haeselbarth G, Muller EC, Jungblut PR and Kaufmann SH [2003]. Comparative proteome analysis of culture supernatant proteins from virulent Mycobacterium tuberculosis H37Rv and attenuated M. bovis BCG Copenhagen. Proteomics
- Wisedchaisri G et al. [2004]. Crystal structure of an IdeR-DNA complex reveals a conformational change in activated IdeR for base-specific interactions. Structure
- Manabe YC et al. [2005]. Both Corynebacterium diphtheriae DtxR(E175K) and Mycobacterium tuberculosis IdeR(D177K) are dominant positive repressors of IdeR-regulated genes in M. tuberculosis. Biochemistry Regulon
- Wisedchaisri G et al. [2007]. Crystal structures, metal activation, and DNA-binding properties of two-domain IdeR from Mycobacterium tuberculosis. Structure
- Lee JH et al. [2008]. Roles of SigB and SigF in the Mycobacterium tuberculosis sigma factor network. Regulon
- MÃ¥len H et al. [2010]. Definition of novel cell envelope associated proteins in Triton X-114 extracts of Mycobacterium tuberculosis H37Rv. Proteomics
- de Souza GA et al. [2011]. Bacterial proteins with cleaved or uncleaved signal peptides of the general secretory pathway. Proteomics
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- de Souza GA et al. [2011]. Proteogenomic analysis of polymorphisms and gene annotation divergences in prokaryotes using a clustered mass spectrometry-friendly database. Proteomics Sequence
- Kelkar DS et al. [2011]. Proteogenomic analysis of Mycobacterium tuberculosis by high resolution mass spectrometry. Proteomics Sequence
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant