Go to browser
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionTranscriptional regulatory protein (repressor and activator), iron-binding repressor of siderophore biosynthesis and iron uptake. Seems to regulate a variety of genes encoding a variety of proteins e.g. transporters, proteins involved in siderophore synthesis and iron storage, members of the PE/PPE family, enzymes involved in lipid metabolism, transcriptional regulatory proteins, etc. Also activator of BFRA|Rv1876 gene.
ProductIron-dependent repressor and activator IdeR
CommentsRv2711, (MTCY05A6.32), len: 230 aa. IdeR (formerly known as dtxR), iron dependent repressor and activator (see citations below), equivalent to Q9CCB5|ML1013 iron dependent repressor from Mycobacterium leprae (230 aa), FASTA scores: opt: 1365, E(): 3.8e-77, (90.0% identity in 230 aa overlap). Also highly similar to others e.g. Q50379|DTXR from Mycobacterium smegmatis (233 aa), FASTA scores: opt: 1291, E(): 1.4e-72, (86.1% identity in 230 aa overlap); Q9F7T3|IDER from Corynebacterium equii (Rhodococcus equi) (230 aa), FASTA scores: opt: 1130, E(): 1.2e-62, (74.8% identity in 230 aa overlap); P33120|DTXR_CORDI from Corynebacterium diphtheriae (226 aa), FASTA scores: opt: 803, E(): 1.6e-42, (57.85% identity in 230 aa overlap); etc. Belongs to the fur family.
Functional categoryRegulatory proteins
ProteomicsIdentified in the membrane fraction of M. tuberculosis H37Rv using 1D-SDS-PAGE and uLC-MS/MS (See Gu et al., 2003). Identified in the culture supernatant of M. tuberculosis H37Rv using mass spectrometry (See Mattow et al., 2003). Identified by mass spectrometry in Triton X-114 extracts of M. tuberculosis H37Rv (See Malen et al., 2010). Identified by mass spectrometry in the membrane protein fraction and whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate (See de Souza et al., 2011). Translational start site supported by proteomics data (See de Souza et al., 2011) (See Kelkar et al., 2011).
TranscriptomicsmRNA level (identified by real-time quantitative RT-PCR) increased 24h after infection of cultured human macrophages (see Hobson et al., 2002). This upregulation could be a consequence of iron deprivation. mRNA also identified by DNA microarray analysis and up-regulated at high temperatures (see Stewart et al., 2002).
MutantEssential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Essential gene, determined by allelic exchange experiments (See Rodriguez et al., 2002). Essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS30235653024257+
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv2711|ideR
MNELVDTTEMYLRTIYDLEEEGVTPLRARIAERLDQSGPTVSQTVSRMERDGLLRVAGDRHLELTEKGRALAIAVMRKHRLAERLLVDVIGLPWEEVHAEACRWEHVMSEDVERRLVKVLNNPTTSPFGNPIPGLVELGVGPEPGADDANLVRLTELPAGSPVAVVVRQLTEHVQGDIDLITRLKDAGVVPNARVTVETTPGGGVTIVIPGHENVTLPHEMAHAVKVEKV
      
Bibliography