Gene Rv2925c
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Digests double-stranded RNA. Involved in the processing of ribosomal RNA precursors and of some mRNAs [catalytic activity: endonucleolytic cleavage to 5'-phosphomonoester]. |
| Product | Probable ribonuclease III Rnc (RNase III) |
| Comments | Rv2925c, (MTCY338.14c), len: 240 aa. Probable rnc, ribonuclease III (RNase III), equivalent to O69469|RNC_MYCLE ribonuclease III from Mycobacterium leprae (238 aa). Also highly similar to other ribonucleases III e.g. Q9ZBQ7|RNC_STRCO from Streptomyces coelicolor (272 aa), FASTA scores: opt: 889, E(): 5.4e-51, (62.2% identity in 225 aa overlap) (N-terminus longer 21 aa); P51833|RNC_BACSU from Bacillus subtilis (249 aa), FASTA scores: opt: 493, E(): 5e-25, (43.25% identity in 215 aa overlap); P05797|RNC_ECOLI|RNC|B2567|Z3848|ECS3433 from Escherichia coli strain O157:H7 and K12 (226 aa), FASTA scores: opt: 459, E(): 7.9e-23, (41.8% identity in 213 aa overlap); etc. Contains PS00517 Ribonuclease III family signature. |
| Functional category | Information pathways |
| Proteomics | Identified by mass spectrometry in Triton X-114 extracts of M. tuberculosis H37Rv (See Malen et al., 2010). Identified by mass spectrometry in the membrane protein fraction and whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate (See de Souza et al., 2011). |
| Mutant | Essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 3239829 | 3240551 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv2925c|rnc
MIRSRQPLLDALGVDLPDELLSLALTHRSYAYENGGLPTNERLEFLGDAVLGLTITDALFHRHPDRSEGDLAKLRASVVNTQALADVARRLCAEGLGVHVLLGRGEANTGGADKSSILADGMESLLGAIYLQHGMEKAREVILRLFGPLLDAAPTLGAGLDWKTSLQELTAARGLGAPSYLVTSTGPDHDKEFTAVVVVMDSEYGSGVGRSKKEAEQKAAAAAWKALEVLDNAMPGKTSA
Bibliography
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Akey DL et al. [2005]. Structure of the nuclease domain of ribonuclease III from M. tuberculosis at 2.1 A. Structure
- MÃ¥len H et al. [2010]. Definition of novel cell envelope associated proteins in Triton X-114 extracts of Mycobacterium tuberculosis H37Rv. Proteomics
- de Souza GA et al. [2011]. Bacterial proteins with cleaved or uncleaved signal peptides of the general secretory pathway. Proteomics
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant