Go to browser
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionTranscriptional activator part of a two component regulatory system.
ProductTwo component sensory transduction transcriptional regulatory protein MtrA
CommentsRv3246c, (MTCY20B11.21c), len: 228 aa. MtrA, transcriptional activator, response regulator (see citations below), equivalent to Q9CCJ2|MTRA|ML0773 putative two-component response regulator from Mycobacterium leprae (228 aa), FASTA scores: opt: 1458, E(): 1.4e-85, (98.7% identity in 228 aa overlap). Also highly similar to others e.g. Q9F9J5|SCRA putative response regulator from Streptomyces coelicolor (228 aa), FASTA scores: opt: 1141, E(): 1.9e-65, (74.9% identity in 227 aa overlap); Q9KYW8|SCE33.15c putative two-component system response regulator from Streptomyces coelicolor (229 aa), FASTA scores: opt: 1141, E(): 1.9e-65, (74.9% identity in 227 aa overlap); Q9F868|REGX3 response regulator REGX3 from Mycobacterium smegmatis (228 aa), FASTA scores: opt: 730, E(): 2.3e-39, (50.90% identity in 222 aa overlap); etc. Relatives in Mycobacterium tuberculosis are: U01971|MTU01971_1; Q11156|RGX3_MYCTU; MTCY20G9.17, E(): 0; MTCY31.31c, E(): 3.4e-29; MTCY369.02, E(): 5.7e-28. Similar to bacterial regulatory proteins involved in signal transduction. The N-terminal region is similar to that of other regulatory components of sensory transduction systems. Experiments showed mtrA is differentially expressed in virulent and avirulent strains during growth in macrophages.
Functional categoryRegulatory proteins
ProteomicsThe product of this CDS corresponds to spot 3_277 identified in culture supernatant by proteomics at the Max Planck Institute for Infection Biology, Berlin, Germany (see proteomics citations). Identified in the membrane fraction of M. tuberculosis H37Rv using 1D-SDS-PAGE and uLC-MS/MS (See Gu et al., 2003). Identified in the culture supernatant of M. tuberculosis H37Rv using mass spectrometry (See Mattow et al., 2003). Identified by mass spectrometry in the culture filtrate and whole cell lysates of M. tuberculosis H37Rv but not the membrane protein fraction (See de Souza et al., 2011). Translational start site supported by proteomics data (See Kelkar et al., 2011).
MutantEssential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Required for growth in C57BL/6J mouse spleen, by transposon site hybridization (TraSH) in H37Rv (See Sassetti and Rubin, 2003). Required for survival in primary murine macrophages, by transposon site hybridization (TraSH) in H37Rv (See Rengarajan et al., 2005). Essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS36266633627349-
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv3246c|mtrA
MDTMRQRILVVDDDASLAEMLTIVLRGEGFDTAVIGDGTQALTAVRELRPDLVLLDLMLPGMNGIDVCRVLRADSGVPIVMLTAKTDTVDVVLGLESGADDYIMKPFKPKELVARVRARLRRNDDEPAEMLSIADVEIDVPAHKVTRNGEQISLTPLEFDLLVALARKPRQVFTRDVLLEQVWGYRHPADTRLVNVHVQRLRAKVEKDPENPTVVLTVRGVGYKAGPP
      
Bibliography