Gene Rv3246c
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Transcriptional activator part of a two component regulatory system. |
| Product | Two component sensory transduction transcriptional regulatory protein MtrA |
| Comments | Rv3246c, (MTCY20B11.21c), len: 228 aa. MtrA, transcriptional activator, response regulator (see citations below), equivalent to Q9CCJ2|MTRA|ML0773 putative two-component response regulator from Mycobacterium leprae (228 aa), FASTA scores: opt: 1458, E(): 1.4e-85, (98.7% identity in 228 aa overlap). Also highly similar to others e.g. Q9F9J5|SCRA putative response regulator from Streptomyces coelicolor (228 aa), FASTA scores: opt: 1141, E(): 1.9e-65, (74.9% identity in 227 aa overlap); Q9KYW8|SCE33.15c putative two-component system response regulator from Streptomyces coelicolor (229 aa), FASTA scores: opt: 1141, E(): 1.9e-65, (74.9% identity in 227 aa overlap); Q9F868|REGX3 response regulator REGX3 from Mycobacterium smegmatis (228 aa), FASTA scores: opt: 730, E(): 2.3e-39, (50.90% identity in 222 aa overlap); etc. Relatives in Mycobacterium tuberculosis are: U01971|MTU01971_1; Q11156|RGX3_MYCTU; MTCY20G9.17, E(): 0; MTCY31.31c, E(): 3.4e-29; MTCY369.02, E(): 5.7e-28. Similar to bacterial regulatory proteins involved in signal transduction. The N-terminal region is similar to that of other regulatory components of sensory transduction systems. Experiments showed mtrA is differentially expressed in virulent and avirulent strains during growth in macrophages. |
| Functional category | Regulatory proteins |
| Proteomics | The product of this CDS corresponds to spot 3_277 identified in culture supernatant by proteomics at the Max Planck Institute for Infection Biology, Berlin, Germany (see proteomics citations). Identified in the membrane fraction of M. tuberculosis H37Rv using 1D-SDS-PAGE and uLC-MS/MS (See Gu et al., 2003). Identified in the culture supernatant of M. tuberculosis H37Rv using mass spectrometry (See Mattow et al., 2003). Identified by mass spectrometry in the culture filtrate and whole cell lysates of M. tuberculosis H37Rv but not the membrane protein fraction (See de Souza et al., 2011). Translational start site supported by proteomics data (See Kelkar et al., 2011). |
| Mutant | Essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Required for growth in C57BL/6J mouse spleen, by transposon site hybridization (TraSH) in H37Rv (See Sassetti and Rubin, 2003). Required for survival in primary murine macrophages, by transposon site hybridization (TraSH) in H37Rv (See Rengarajan et al., 2005). Essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 3626663 | 3627349 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv3246c|mtrA
MDTMRQRILVVDDDASLAEMLTIVLRGEGFDTAVIGDGTQALTAVRELRPDLVLLDLMLPGMNGIDVCRVLRADSGVPIVMLTAKTDTVDVVLGLESGADDYIMKPFKPKELVARVRARLRRNDDEPAEMLSIADVEIDVPAHKVTRNGEQISLTPLEFDLLVALARKPRQVFTRDVLLEQVWGYRHPADTRLVNVHVQRLRAKVEKDPENPTVVLTVRGVGYKAGPP
Bibliography
- Via LE et al. [1996]. Elements of signal transduction in Mycobacterium tuberculosis: in vitro phosphorylation and in vivo expression of the response regulator MtrA. Secondary Regulation
- Mollenkopf HJ et al. [1999]. A dynamic two-dimensional polyacrylamide gel electrophoresis database: the mycobacterial proteome via Internet. Proteomics
- Jungblut PR, Schaible UE, Mollenkopf HJ, Zimny-Arndt U, Raupach B, Mattow J, Halada P, Lamer S, Hagens K and Kaufmann SH [1999]. Comparative proteome analysis of Mycobacterium tuberculosis and Mycobacterium bovis BCG strains: towards functional genomics of microbial pathogens. Proteomics
- Zahrt TC et al. [2000]. An essential two-component signal transduction system in Mycobacterium tuberculosis. Secondary Regulation
- Gu S et al. [2003]. Comprehensive proteomic profiling of the membrane constituents of a Mycobacterium tuberculosis strain. Proteomics
- Mattow J, Schaible UE, Schmidt F, Hagens K, Siejak F, Brestrich G, Haeselbarth G, Muller EC, Jungblut PR and Kaufmann SH [2003]. Comparative proteome analysis of culture supernatant proteins from virulent Mycobacterium tuberculosis H37Rv and attenuated M. bovis BCG Copenhagen. Proteomics
- Sassetti CM and Rubin EJ [2003]. Genetic requirements for mycobacterial survival during infection. Mutant
- Rengarajan J et al. [2005]. Genome-wide requirements for Mycobacterium tuberculosis adaptation and survival in macrophages. Mutant
- Friedland N et al. [2007]. Domain orientation in the inactive response regulator Mycobacterium tuberculosis MtrA provides a barrier to activation. Structure
- de Souza GA et al. [2011]. Bacterial proteins with cleaved or uncleaved signal peptides of the general secretory pathway. Proteomics
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- Kelkar DS et al. [2011]. Proteogenomic analysis of Mycobacterium tuberculosis by high resolution mass spectrometry. Proteomics Sequence
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant