Gene Rv3316
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Involved in tricarboxylic acid cycle. Mono-heme cytochrome of the succinate dehydrogenase complex. |
| Product | Probable succinate dehydrogenase (cytochrome B-556 subunit) SdhC (succinic dehydrogenase) (fumarate reductase) (fumarate dehydrogenase) (fumaric hydrogenase) |
| Comments | Rv3316, (MTV016.16), len: 112 aa. Probable sdhC, cytochrome B-556 of succinate dehydrogenase SdhC subunit , transmembrane protein, equivalent (but shorter 35 aa) to Q9CCM0|SDHC|ML0699 putative succinate dehydrogenase cytochrome B-556 subunit from Mycobacterium leprae (153 aa), FASTA scores: opt: 692, E(): 1.2e-39, (88.4% identity in 112 aa overlap). Also similar to others e.g. Q9KZ88|SC5G8.26c from Streptomyces coelicolor (126 aa), FASTA scores: opt: 484, E(): 8.3e-26, (65.65% identity in 99 aa overlap); Q9RVR8|DR0954 from Deinococcus radiodurans (118 aa), FASTA scores: opt: 195, E(): 1.7e-06, (36.8% identity in 87 aa overlap); Q9HQ63|DHSD_HALN1|SDHD|SDHC|VNG1310G from Halobacterium sp. strain NRC-1 (130 aa), FASTA scores: opt: 192, E(): 2.9e-06, (37.85% identity in 74 aa overlap); P72109|DHSD_NATPH|SDHD|SDHC from Natronomonas pharaonis (Natronobacterium pharaonis) (130 aa), FASTA scores: opt: 183, E(): 1.1e-05, (35.15% identity in 74 aa overlap); etc. Part of an enzyme complex containing four subunits: a flavoprotein, an iron-sulfur, cytochrome B-556, and an hydrophobic anchor protein. Belongs to the cytochrome B560 family. |
| Functional category | Intermediary metabolism and respiration |
| Proteomics | Identified by mass spectrometry in Triton X-114 extracts of M. tuberculosis H37Rv (See Malen et al., 2010). Identified by mass spectrometry in the membrane protein fraction and whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate (See de Souza et al., 2011). |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 3704102 | 3704440 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv3316|sdhC
MWSWVCHRISGATIFFFLFVHVLDAAMLRVSPQTYNAVLATYKTPIVGLMEYGLVAAVLFHALNGIRVILIDFWSEGPRYQRLMLWIIGSVFLLLMVPAGVVVGIHMWEHFR
Bibliography
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Målen H et al. [2010]. Definition of novel cell envelope associated proteins in Triton X-114 extracts of Mycobacterium tuberculosis H37Rv. Proteomics
- de Souza GA et al. [2011]. Bacterial proteins with cleaved or uncleaved signal peptides of the general secretory pathway. Proteomics
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant
