Gene Rv3337
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Function unknown |
| Product | Conserved hypothetical protein |
| Comments | Rv3337, (MTV016.37), len: 128 aa. Conserved hypothetical protein, equivalent to N-terminus of Q49926|ML0685 TPEA (putative hydrolase) from Mycobacterium leprae (303 aa), FASTA scores: opt: 362, E(): 5.7e-17, (74.3% identity in 70 aa overlap). Also weak similarity in N-terminus to Q98JT7|BAB49078|MLR1789 probable epoxide hydrolase from Rhizobium loti (Mesorhizobium loti) (300 aa), FASTA scores: opt: 122, E(): 0.74, (31.95% identity in 97 aa overlap). Homology suggests this ORF should be in frame with the following ORF MTV016.38 but no sequence error could be found. Short distance to start of trpS suggests region may not be protein-coding. C-terminus extended since first submission (+47 aa). |
| Functional category | Conserved hypotheticals |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 3723656 | 3724042 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv3337|Rv3337
VPSPSTTGHHAACGTGGTGFSVGSMRSPIRVGSGEPVLLLHPFLMSQTVWEKVAQQLADTGRFEVFAPTMAGHNGGPASGTRFCPRRCWPTTSNASSTNWAGKPAISSATRWAAGSRSNSNDVAGHAA
Bibliography
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant
