Go to browser
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionFunction unknown
ProductConserved hypothetical protein
CommentsRv3337, (MTV016.37), len: 128 aa. Conserved hypothetical protein, equivalent to N-terminus of Q49926|ML0685 TPEA (putative hydrolase) from Mycobacterium leprae (303 aa), FASTA scores: opt: 362, E(): 5.7e-17, (74.3% identity in 70 aa overlap). Also weak similarity in N-terminus to Q98JT7|BAB49078|MLR1789 probable epoxide hydrolase from Rhizobium loti (Mesorhizobium loti) (300 aa), FASTA scores: opt: 122, E(): 0.74, (31.95% identity in 97 aa overlap). Homology suggests this ORF should be in frame with the following ORF MTV016.38 but no sequence error could be found. Short distance to start of trpS suggests region may not be protein-coding. C-terminus extended since first submission (+47 aa).
Functional categoryConserved hypotheticals
MutantNon-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS37236563724042+
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv3337|Rv3337
VPSPSTTGHHAACGTGGTGFSVGSMRSPIRVGSGEPVLLLHPFLMSQTVWEKVAQQLADTGRFEVFAPTMAGHNGGPASGTRFCPRRCWPTTSNASSTNWAGKPAISSATRWAAGSRSNSNDVAGHAA