Go to browser
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionInvolved in translation mechanism. This protein is one of the early assembly proteins of the 50S ribosomal subunit.
Product50S ribosomal protein L13 RplM
CommentsRv3443c, (MTCY77.15c), len: 147 aa. rplM, 50S ribosomal protein L13, equivalent to P38014|RL13_MYCLE|RPLM|ML0364|B229_C3_232 from Mycobacterium leprae (147 aa), FASTA scores: opt: 917, E(): 7.5e-53, (91.15% identity in 147 aa overlap). Also highly similar to others e.g. Q53874|RL13_STRCO|RPLM|SC6G4.12 from Streptomyces coelicolor (147 aa), FASTA scores: opt: 668, E(): 1.1e-36, (65.5% identity in 145 aa overlap); Q9X1G5|RL13_THEMA|RPLM|TM1454 from Thermotoga maritima (149 aa), FASTA scores: opt: 536, E(): 4.4e-28, (53.65% identity in 136 aa overlap); O67722|RL13_AQUAE|RPLM|AQ_1877 from Aquifex aeolicus (144 aa), FASTA scores: opt: 529, E(): 1.2e-27, (53.2% identity in 141 aa overlap); etc. Belongs to the L13P family of ribosomal proteins.
Functional categoryInformation pathways
ProteomicsIdentified in the membrane fraction of M. tuberculosis H37Rv using 1D-SDS-PAGE and uLC-MS/MS (See Gu et al., 2003). Identified in the cytosol of M. tuberculosis H37Rv using 2DLC/MS (See Mawuenyega et al., 2005). Identified in the detergent phase of Triton X-114 extracts of M. tuberculosis H37Rv membranes using CEGE and MALDI-TOF-MS (See Sinha et al., 2005). Identified by mass spectrometry in Triton X-114 extracts of M. tuberculosis H37Rv (See Malen et al., 2010). Identified by mass spectrometry in the membrane protein fraction and whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate (See de Souza et al., 2011).
TranscriptomicsmRNA identified by microarray analysis and down-regulated after 96h of starvation (see citation below).
MutantEssential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS38619473862390-
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv3443c|rplM
VPTYAPKAGDTTRSWYVIDATDVVLGRLAVAAANLLRGKHKPTFAPNVDGGDFVIVINADKVAISGDKLQHKMVYRHSGYPGGLHKRTIGELMQRHPDRVVEKAILGMLPKNRLSRQIQRKLRVYAGPEHPHSAQQPVPYELKQVAQ
      
Bibliography