Go to browser
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionInvolved in dTDP-L-rhamnose biosynthesis, within the O antigen biosynthesis pathway of lipopolysaccharide biosynthesis: conversion of dTDP-4-keto-6-deoxy-D-glucose to dTDP-4-keto-rhamnose [catalytic activity: dTDP-4-dehydro-6-deoxy-D-glucose = dTDP-4-dehydro-6-deoxy-L-mannose].
ProductdTDP-4-dehydrorhamnose 3,5-epimerase RmlC (dTDP-4-keto-6-deoxyglucose 3,5-epimerase) (dTDP-L-rhamnose synthetase) (thymidine diphospho-4-keto-rhamnose 3,5-epimerase)
CommentsRv3465, (MTCY13E12.18), len: 202 aa. RmlC (alternate gene name: rfbC), dTDP-4-dehydrorhamnose 3,5-epimerase (see citations below), nearly identical to O33170|RMLC RMLC protein from Mycobacterium tuberculosis (203 aa), FASTA scores: opt: 1171, E(): 2.6e-71, (89.5% identity in 200 aa overlap) (previously known as rfbC). Equivalent to Q9X7A4|RMLC|ML1965 putative dTDP-4-dehydrorhamnose 3,5-epimerase from Mycobacterium leprae (202 aa), FASTA scores: opt: 1072, E(): 1.1e-64, (75.4% identity in 199 aa overlap). Also highly similar to others e.g. Q9F8S7|CUMY from Streptomyces rishiriensis (198 aa), FASTA scores: opt: 671, E(): 7e-38, (51.3% identity in 193 aa overlap); Q9L6C5 from Streptomyces antibioticus (202 aa), FASTA scores: opt: 665, E(): 1.8e-37, (49.25% identity in 197 aa overlap); P29783|STRM_STRGR from Streptomyces griseus (200 aa), FASTA scores: opt: 608, E(): 1.2e-33, (49.25% identity in 201 aa overlap); Q54265|STRM from Streptomyces glaucescens (200 aa), FASTA scores: opt: 603, E(): 2.5e-33, (46.7% identity in 197 aa overlap); etc. Also highly similar to Q9S4D4|TYLJ putative NDP-hexose 3-epimerase from Streptomyces fradiae (205 aa), FASTA scores: opt: 625, E(): 8.6e-35, (45.9% identity in 194 aa overlap).
Functional categoryIntermediary metabolism and respiration
ProteomicsIdentified by mass spectrometry in Triton X-114 extracts of M. tuberculosis H37Rv (See Malen et al., 2010). Identified by mass spectrometry in the culture filtrate, membrane protein fraction, and whole cell lysates of M. tuberculosis H37Rv (See de Souza et al., 2011).
TranscriptomicsmRNA identified by microarray analysis and down-regulated after 24h and 96h of starvation (see Betts et al., 2002).
MutantEssential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). M. smegmatis knockout shows rmlC is essential for growth (See Li et al., 2006).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS38828343883442+
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv3465|rmlC
MKARELDVPGAWEITPTIHVDSRGLFFEWLTDHGFRAFAGHSLDVRQVNCSVSSAGVLRGLHFAQLPPSQAKYVTCVSGSVFDVVVDIREGSPTFGRWDSVLLDDQDRRTIYVSEGLAHGFLALQDNSTVMYLCSAEYNPQREHTICATDPTLAVDWPLVDGAAPSLSDRDAAAPSFEDVRASGLLPRWEQTQRFIGEMRGT
      
Bibliography