Go to browser
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionFunction not known: possibly acts on thioredoxin.
ProductPossible membrane-anchored thioredoxin-like protein (thiol-disulfide interchange related protein)
CommentsRv3673c, (MTV025.021c), len: 227 aa. Possible membrane protein, thioredoxin-like protein (thiol-disulfide interchange protein), equivalent to Q9CB93|ML2300 putative membrane protein from Mycobacterium leprae (215 aa), FASTA scores: opt: 978, E(): 2.5e-52, (71.15% identity in 215 aa overlap). Some similarity with thioredoxin-related proteins e.g. P35160|RESA_BACSU RESA protein from Bacillus subtilis (181 aa), FASTA scores: opt: 212, E(): 5.7e-06, (30.55% identity in 108 aa overlap); Q9RXW6|DR0189 thiol:disulfide interchange protein from Deinococcus radiodurans (185 aa) FASTA scores: opt: 206, E(): 1.3e-05, (33.8% identity in 139 aa overlap); Q9I505|PA0953 probable thioredoxin from Pseudomonas aeruginosa (154 aa), FASTA scores: opt: 180, E(): 0.00044, (34.85% identity in 109 aa overlap); Q9KCP7|BH1522 thioredoxin (thiol:disulfide interchange protein) from Bacillus halodurans (177 aa), FASTA scores: opt: 178, E(): 0.00064, (31.75% identity in 107 aa overlap); P43221|TLPA_BRAJA thiol:disulfide interchange protein (cytochrome C biogenesis protein) from Bradyrhizobium japonicum (221 aa), FASTA scores: opt: 189, E(): 0.00017, (26.85% identity in 227 aa overlap); etc. Also similar to O06392|Rv0526|MTCY25D10.05 hypothetical 23.2 KDA protein from Mycobacterium tuberculosis (216 aa) FASTA scores: opt: 160, E(): 0.0093, (27.45% identity in 142 aa overlap). Contains PS00194 Thioredoxin family active site. Possibly belongs to the thioredoxin family.
Functional categoryIntermediary metabolism and respiration
ProteomicsIdentified by mass spectrometry in Triton X-114 extracts of M. tuberculosis H37Rv (See Malen et al., 2010). Identified by mass spectrometry in the membrane protein fraction of M. tuberculosis H37Rv but not the culture filtrate or membrane protein fraction (See de Souza et al., 2011).
MutantEssential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS41144744115157-
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv3673c|Rv3673c
MPSLPTTPAETAMTTLTGKTRWTIAILAVVAALMAALVAQLHDYSASSTISQRPAPREHRDGDTPEALAWSRQRANLPPCPAAGNGPGAAALRGVVVVCAGDGSAVDVARALAGRRVVINLWAHWCAPCMTELPVMAEYQRRVGPAVLVVTVHQGQNEAAALSRLADLGVRLPTLQDDRRRVAAALRVANVMPATVVLRPDGSVAQTLPRAFGSADEIVAAVGNDAG