Gene Rv3673c
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Function not known: possibly acts on thioredoxin. |
| Product | Possible membrane-anchored thioredoxin-like protein (thiol-disulfide interchange related protein) |
| Comments | Rv3673c, (MTV025.021c), len: 227 aa. Possible membrane protein, thioredoxin-like protein (thiol-disulfide interchange protein), equivalent to Q9CB93|ML2300 putative membrane protein from Mycobacterium leprae (215 aa), FASTA scores: opt: 978, E(): 2.5e-52, (71.15% identity in 215 aa overlap). Some similarity with thioredoxin-related proteins e.g. P35160|RESA_BACSU RESA protein from Bacillus subtilis (181 aa), FASTA scores: opt: 212, E(): 5.7e-06, (30.55% identity in 108 aa overlap); Q9RXW6|DR0189 thiol:disulfide interchange protein from Deinococcus radiodurans (185 aa) FASTA scores: opt: 206, E(): 1.3e-05, (33.8% identity in 139 aa overlap); Q9I505|PA0953 probable thioredoxin from Pseudomonas aeruginosa (154 aa), FASTA scores: opt: 180, E(): 0.00044, (34.85% identity in 109 aa overlap); Q9KCP7|BH1522 thioredoxin (thiol:disulfide interchange protein) from Bacillus halodurans (177 aa), FASTA scores: opt: 178, E(): 0.00064, (31.75% identity in 107 aa overlap); P43221|TLPA_BRAJA thiol:disulfide interchange protein (cytochrome C biogenesis protein) from Bradyrhizobium japonicum (221 aa), FASTA scores: opt: 189, E(): 0.00017, (26.85% identity in 227 aa overlap); etc. Also similar to O06392|Rv0526|MTCY25D10.05 hypothetical 23.2 KDA protein from Mycobacterium tuberculosis (216 aa) FASTA scores: opt: 160, E(): 0.0093, (27.45% identity in 142 aa overlap). Contains PS00194 Thioredoxin family active site. Possibly belongs to the thioredoxin family. |
| Functional category | Intermediary metabolism and respiration |
| Proteomics | Identified by mass spectrometry in Triton X-114 extracts of M. tuberculosis H37Rv (See Malen et al., 2010). Identified by mass spectrometry in the membrane protein fraction of M. tuberculosis H37Rv but not the culture filtrate or membrane protein fraction (See de Souza et al., 2011). |
| Mutant | Essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 4114474 | 4115157 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv3673c|Rv3673c
MPSLPTTPAETAMTTLTGKTRWTIAILAVVAALMAALVAQLHDYSASSTISQRPAPREHRDGDTPEALAWSRQRANLPPCPAAGNGPGAAALRGVVVVCAGDGSAVDVARALAGRRVVINLWAHWCAPCMTELPVMAEYQRRVGPAVLVVTVHQGQNEAAALSRLADLGVRLPTLQDDRRRVAAALRVANVMPATVVLRPDGSVAQTLPRAFGSADEIVAAVGNDAG
Bibliography
- Målen H et al. [2010]. Definition of novel cell envelope associated proteins in Triton X-114 extracts of Mycobacterium tuberculosis H37Rv. Proteomics
- de Souza GA et al. [2011]. Bacterial proteins with cleaved or uncleaved signal peptides of the general secretory pathway. Proteomics
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant
