Go to browser
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionFunction unknown; probably involved in deamination of specific substrate.
ProductPossible cytidine/deoxycytidylate deaminase
CommentsRv3752c, (MTV025.100c), len: 152 aa. Probable cytidine/deoxycytidylate deaminase, equivalent to Q9CB32|ML2474 possible cytidine/deoxycytidylate deaminase from Mycobacterium leprae (171 aa), FASTA scores: opt: 890, E(): 1.6e-50, (88.1% identity in 151 aa overlap). Also highly similar to other deaminases and hypothetical proteins e.g. Q9AK79|2SCD60.04c putative deaminase from Streptomyces coelicolor (143 aa), FASTA scores: opt: 559, E(): 2.9e-29, (66.45% identity in 146 aa overlap); Q9F9W7 cytosine deaminase from Bifidobacterium longum (143 aa) FASTA scores: opt: 512, E(): 3.1e-26, (54.85% identity in 144 aa overlap); P21335|YAAJ_BACSU hypothetical 17.8 KDA protein from Bacillus subtilis (161 aa), FASTA scores: opt: 425, E(): 1.4e-20, (47.7% identity in 151 aa overlap); AAK74212|SP0020 cytidine/deoxycytidylate deaminase family protein from Streptococcus pneumoniae (155 aa), FASTA scores: opt: 401, E(): 4.7e-19, (46.25% identity in 147 aa overlap); P30134|YFHC_ECOLI|B2559 hypothetical 20.0 KDA protein from Escherichia coli strain K12 (178 aa), FASTA scores: opt: 397, E(): 9.5e-19, (47.0% identity in 149 aa overlap); etc. Contains PS00903 Cytidine and deoxycytidylate deaminases zinc-binding region signature. Belongs to the cytidine and deoxycytidylate deaminases family.
Functional categoryIntermediary metabolism and respiration
ProteomicsIdentified by mass spectrometry in M. tuberculosis H37Rv-infected guinea pig lungs at 90 days but not 30 days (See Kruh et al., 2010). Identified by mass spectrometry in whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate or membrane protein fraction (See de Souza et al., 2011).
MutantEssential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS41992474199705-
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv3752c|Rv3752c
VTTDEDLIRAALAVAATAGPRDVPVGAVVVGADGTELARAVNAREALGDPTAHAEILAMRLAAGVLGDGWRLEGTTLAVTVEPCTMCAGALVLARVARLVFGAWEPKTGAVGSLWDVVRDRRLNHRPEVRGGVLARECAAPLEAFFARQRLG