Gene Rv3855 (aka, etaR)
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Regulates negatively the production of ETHA. Induced ETH resistance when overexpressed in Mycobacterium tuberculosis. |
| Product | Transcriptional regulatory repressor protein (TetR-family) EthR |
| Comments | Rv3855, (MTCY01A6.13c), len: 216 aa. EthR (alternate gene names: aka, etaR), regulatory protein TetR family, involved in ethionamide sensitivity/resistance, negatively controls neighbouring ethA (Rv3854c, MTCY01A6.14; alternate gene names: aka etaA) (see citations below). Equivalent to Q9CDD3|ML0064 putative transcriptional regulator from Mycobacterium leprae (214 aa), FASTA scores: opt: 1017, E(): 7e-62, (77.0% identity in 213 aa overlap). Also similar to other transcriptional regulator e.g. Q9S1R1|SCJ9A.09 putative TetR-family transcriptional regulator from Streptomyces coelicolor (204 aa), FASTA scores: opt: 305, E(): 1.2e-13, (34.5% identity in 200 aa overlap); Q9KYT9|SCE22.24 putative TetR-family transcriptional regulator (fragment) from Streptomyces coelicolor (244 aa), FASTA scores: opt: 179, E(): 4.9e-05, (35.5% identity in 93 aa overlap); Q9RUK2|DR1384 transcriptional regulator (TetR family) from Deinococcus radiodurans (196 aa), FASTA scores: opt: 167, E(): 0.00026, (41.75% identity in 79 aa overlap); etc. Also similar to P95100|Rv3058c|MTCY22D7.23 hypothetical 23.8 KDA protein from Mycobacterium tuberculosis (216 aa) FASTA scores: opt: 261, E(): 1.2e-10, (31.65% identity in 221 aa overlap); and O08377|Rv1534|MTCY07A7A.03 hypothetical 24.5 KDA protein from Mycobacterium tuberculosis (225 aa), FASTA scores: opt: 164, E(): 0.00047, (25.5% identity in 248 aa overlap). Contains helix-turn-helix motif at aa 45-66, Score 1320 (+3.68 SD). Belongs to the TetR/AcrR family of transcriptional regulators. |
| Functional category | Regulatory proteins |
| Proteomics | Identified in the cytosol of M. tuberculosis H37Rv using 2DLC/MS (See Mawuenyega et al., 2005). Identified by mass spectrometry in whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate or membrane protein fraction (See de Souza et al., 2011). |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Required for growth in C57BL/6J mouse spleen, by transposon site hybridization (TraSH) in H37Rv (See Sassetti and Rubin, 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 4327549 | 4328199 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv3855|ethR
VTTSAASQASLPRGRRTARPSGDDRELAILATAENLLEDRPLADISVDDLAKGAGISRPTFYFYFPSKEAVLLTLLDRVVNQADMALQTLAENPADTDRENMWRTGINVFFETFGSHKAVTRAGQAARATSVEVAELWSTFMQKWIAYTAAVIDAERDRGAAPRTLPAHELATALNLMNERTLFASFAGEQPSVPEARVLDTLVHIWVTSIYGENR
Bibliography
- DeBarber AE et al. [2000]. Ethionamide activation and sensitivity in multidrug-resistant Mycobacterium tuberculosis. Product Function Mutant
- Baulard AR et al. [2000]. Activation of the pro-drug ethionamide is regulated in mycobacteria. Mutant Function
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Sassetti CM and Rubin EJ [2003]. Genetic requirements for mycobacterial survival during infection. Mutant
- Dover LG et al. [2004]. Crystal structure of the TetR/CamR family repressor Mycobacterium tuberculosis EthR implicated in ethionamide resistance. Structure
- Mawuenyega KG et al. [2005]. Mycobacterium tuberculosis functional network analysis by global subcellular protein profiling. Proteomics
- de Souza GA et al. [2011]. Bacterial proteins with cleaved or uncleaved signal peptides of the general secretory pathway. Proteomics
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant