Go to browser
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionInvolved in thiamine biosynthesis. Condenses 4-methyl-5-(beta-hydroxyethyl)-thiazole monophosphate (THZ-P) and 4-amino-5-hydroxymethyl pyrimidine pyrophosphate (HMP-pp) to form thiamine monophosphate (TMP) [catalytic activity: 2-methyl-4-amino-5-hydroxymethylpyrimidine diphosphate + 4-4-methyl-5-(2-phosphonooxyethyl)-thiazole = diphosphate + thiamine monophosphate].
ProductThiamine-phosphate pyrophosphorylase ThiE (TMP pyrophosphorylase) (TMP-PPASE) (thiamine-phosphate synthase)
CommentsRv0414c, (MTCY22G10.11c), len: 222 aa. thiE, thiamin phosphate pyrophosphorylase, equivalent to Q9ZBL5|AL035159|MLCB1450_17 probable thiamine-phosphate pyrophosphorylase from Mycobacterium leprae (235 aa), FASTA scores: opt: 1095, E(): 0, (78.0% identity in 223 aa overlap). Also similar to others e.g. T34974|5689976|CAB52013.1|AL109663 probable thiamin phosphate pyrophosphorylase from Streptomyces coelicolor (223 aa); THIE_ECOLI|P30137 thie protein from Escherichia coli strain K12 (211 aa), FASTA scores: opt: 275, E(): 7.8e-12, (37.8% identity in 196 aa overlap); etc. Belongs to the TMP-PPASE family.
Functional categoryIntermediary metabolism and respiration
ProteomicsIdentified by mass spectrometry in Triton X-114 extracts of M. tuberculosis H37Rv (See Malen et al., 2010). Identified by mass spectrometry in the membrane protein fraction and whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate (See de Souza et al., 2011).
MutantEssential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Required for growth in C57BL/6J mouse spleen, by transposon site hybridization (TraSH) in H37Rv (See Sassetti and Rubin, 2003). Essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS500350501018-
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv0414c|thiE
VHESRLASARLYLCTDARRERGDLAQFAEAALAGGVDIIQLRDKGSPGELRFGPLQARDELAACEILADAAHRYGALFAVNDRADIARAAGADVLHLGQRDLPVNVARQILAPDTLIGRSTHDPDQVAAAAAGDADYFCVGPCWPTPTKPGRAAPGLGLVRVAAELGGDDKPWFAIGGINAQRLPAVLDAGARRIVVVRAITSADDPRAAAEQLRSALTAAN