Gene Rv0985c
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Ion channel that opens in response to stretch forces in the membrane lipid bilayer. May participate in the regulation of osmotic pressure changes within the cell. |
| Product | Possible large-conductance ion mechanosensitive channel MscL |
| Comments | Rv0985c, (MTV044.13c), len: 151 aa. Possible mscL, large conductance mechanosensitive ion channel (integral membrane protein) (see citations below, equivalent to AL035500|MLCL373_19|NP_301254.1|NC_002677 putative mechanosensitive channel protein from Mycobacterium leprae (154 aa), FASTA score: (71.0% identity in 155 aa overlap). Also highly similar to others e.g. NP_268999.1|NC_002737 putative large conductance mechanosensitive channel from Streptococcus pyogenes (120 aa); CAB90974.1|AL355832 putative mechanosensitive channel from Streptomyces coelicolor (156 aa); Q9X722|MSCL_CLOHI large-conductance mechanosensitive channel from Clostridium histolyticum (133 aa); Z83337|BSZ83337_6 large conductance mechanosensitive channel from Bacillus subtilis (130 aa), FASTA scores: opt: 248, E(): 8.4e-10, (39.0% identity in 136 aa overlap); U08371|ECU08371_1 large conductance mechanosensitive channel from Escherichia coli strain K-12 (136 aa), FASTA score: (36.6% identity in 134 aa overlap); etc. Belongs to the MscL family. |
| Functional category | Cell wall and cell processes |
| Proteomics | Identified in the membrane fraction of M. tuberculosis H37Rv using 1D-SDS-PAGE and uLC-MS/MS; predicted transmembrane protein (See Gu et al., 2003). Identified in the membrane fraction of M. tuberculosis H37Rv using nanoLC-MS/MS; predicted integral membrane protein (See Xiong et al., 2005). Identified by mass spectrometry in Triton X-114 extracts of M. tuberculosis H37Rv (See Malen et al., 2010). Identified by mass spectrometry in the membrane protein fraction and whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate (See de Souza et al., 2011). |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 1101025 | 1101480 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv0985c|mscL
MLKGFKEFLARGNIVDLAVAVVIGTAFTALVTKFTDSIITPLINRIGVNAQSDVGILRIGIGGGQTIDLNVLLSAAINFFLIAFAVYFLVVLPYNTLRKKGEVEQPGDTQVVLLTEIRDLLAQTNGDSPGRHGGRGTPSPTDGPRASTESQ
Bibliography
- Chang G et al. [1998]. Structure of the MscL homolog from Mycobacterium tuberculosis: a gated mechanosensitive ion channel. Structure
- Maurer JA et al. [2000]. Comparing and contrasting Escherichia coli and Mycobacterium tuberculosis mechanosensitive channels (MscL). New gain of function mutations in the loop region. Sequence Structure
- Elmore DE et al. [2001]. Molecular dynamics simulations of wild-type and mutant forms of the Mycobacterium tuberculosis MscL channel. Mutant Function Structure
- Sukharev S et al. [2001]. Structural models of the MscL gating mechanism. Structure Function
- Gullingsrud J et al. [2001]. Structural determinants of MscL gating studied by molecular dynamics simulations. Structure
- Betanzos M et al. [2002]. A large iris-like expansion of a mechanosensitive channel protein induced by membrane tension. Homolog Function Structure
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Gu S et al. [2003]. Comprehensive proteomic profiling of the membrane constituents of a Mycobacterium tuberculosis strain. Proteomics
- Xiong Y, Chalmers MJ, Gao FP, Cross TA and Marshall AG [2005]. Identification of Mycobacterium tuberculosis H37Rv integral membrane proteins by one-dimensional gel electrophoresis and liquid chromatography electrospray ionization tandem mass spectrometry. Proteomics
- MÃ¥len H et al. [2010]. Definition of novel cell envelope associated proteins in Triton X-114 extracts of Mycobacterium tuberculosis H37Rv. Proteomics
- de Souza GA et al. [2011]. Bacterial proteins with cleaved or uncleaved signal peptides of the general secretory pathway. Proteomics
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant