Go to browser
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionIon channel that opens in response to stretch forces in the membrane lipid bilayer. May participate in the regulation of osmotic pressure changes within the cell.
ProductPossible large-conductance ion mechanosensitive channel MscL
CommentsRv0985c, (MTV044.13c), len: 151 aa. Possible mscL, large conductance mechanosensitive ion channel (integral membrane protein) (see citations below, equivalent to AL035500|MLCL373_19|NP_301254.1|NC_002677 putative mechanosensitive channel protein from Mycobacterium leprae (154 aa), FASTA score: (71.0% identity in 155 aa overlap). Also highly similar to others e.g. NP_268999.1|NC_002737 putative large conductance mechanosensitive channel from Streptococcus pyogenes (120 aa); CAB90974.1|AL355832 putative mechanosensitive channel from Streptomyces coelicolor (156 aa); Q9X722|MSCL_CLOHI large-conductance mechanosensitive channel from Clostridium histolyticum (133 aa); Z83337|BSZ83337_6 large conductance mechanosensitive channel from Bacillus subtilis (130 aa), FASTA scores: opt: 248, E(): 8.4e-10, (39.0% identity in 136 aa overlap); U08371|ECU08371_1 large conductance mechanosensitive channel from Escherichia coli strain K-12 (136 aa), FASTA score: (36.6% identity in 134 aa overlap); etc. Belongs to the MscL family.
Functional categoryCell wall and cell processes
ProteomicsIdentified in the membrane fraction of M. tuberculosis H37Rv using 1D-SDS-PAGE and uLC-MS/MS; predicted transmembrane protein (See Gu et al., 2003). Identified in the membrane fraction of M. tuberculosis H37Rv using nanoLC-MS/MS; predicted integral membrane protein (See Xiong et al., 2005). Identified by mass spectrometry in Triton X-114 extracts of M. tuberculosis H37Rv (See Malen et al., 2010). Identified by mass spectrometry in the membrane protein fraction and whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate (See de Souza et al., 2011).
MutantNon-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS11010251101480-
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv0985c|mscL
MLKGFKEFLARGNIVDLAVAVVIGTAFTALVTKFTDSIITPLINRIGVNAQSDVGILRIGIGGGQTIDLNVLLSAAINFFLIAFAVYFLVVLPYNTLRKKGEVEQPGDTQVVLLTEIRDLLAQTNGDSPGRHGGRGTPSPTDGPRASTESQ
      
Bibliography