Go to browser
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionBidirectionally degrades single-stranded DNA into large acid-insoluble oligonucleotides, which are then degraded further into small acid-soluble oligonucleotides [catalytic activity: exonucleolytic cleavage in either 5'- to 3'- or 3'- to 5'-direction to yield 5'-phosphomononucleotides.]
ProductProbable exodeoxyribonuclease VII (small subunit) XseB (exonuclease VII small subunit)
CommentsRv1107c, (MTV017.60c), len: 85 aa. Probable xseB, exonuclease VII small subunit (see citation below). Equivalent to AL049491|MLCB1222_6 Mycobacterium leprae (87 aa) (77.9% identity in 68 aa overlap). Similar to P43914|EX7S_HAEIN exodeoxyribonuclease small subunit from H. influenzae (84 aa), FASTA scores: opt: 126, E(): 0.006, (37.3% identity in 67 aa overlap); and P22938|EX7S_ECOLI exodeoxyribonuclease small subunit from Escherichia coli (79 aa), FASTA scores: opt: 125, E(): 0.0067, (39.7% identity in 58 aa overlap). Belongs to the XseB family.
Functional categoryInformation pathways
MutantNon-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv and CDC1551 strains (see Sassetti et al., 2003 and Lamichhane et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS12339661234223-
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv1107c|xseB
MVCDPNGDDTGRTHATVPVSQLGYEACRDELMEVVRLLEQGGLDLDASLRLWERGEQLAKRCEEHLAGARQRVSDVLAGDEAQNG