Gene Rv2671 (ribG)
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Involved in riboflavin biosynthesis (at the second and third steps). Converts 2,5-diamino-6-(ribosylamino)-4(3H)-pyrimidinone 5'-phosphate into 5-amino-6-(ribosylamino)-2,4(1H,3H)-pyrimidinedione 5'-phosphate [catalytic activity 1: 2,5-diamino-6-hydroxy-4-(5-phosphoribosylamino)pyrimidine + H(2)O = 5-amino-6-(5-phosphoribosylamino)uracil + NH(3)] [catalytic activity 2: 5-amino-6-(5-phosphoribitylamino)uracil + NADP(+) = 5-amino-6-(5-phosphoribosylamino)uracil + NADPH]. |
| Product | Possible bifunctional enzyme riboflavin biosynthesis protein RibD: diaminohydroxyphosphoribosylaminopyrimidine deaminase (riboflavin-specific deaminase) + 5-amino-6-(5-phosphoribosylamino)uracil reductase (HTP reductase) |
| Comments | Rv2671, (MTCY441.40), len: 258 aa. Possible ribD (alternate gene name: ribG), bifunctional riboflavin biosynthesis protein incuding diaminohydroxyphosphoribosylaminopyrimidine deaminase and 5-amino-6-(5-phosphoribosylamino) uracil reductase, highly similar to O05684|MLC1351.23|ML1340 possible reductase from Mycobacterium leprae (268 aa), FASTA scores: opt: 1211, E(): 3e-68, (72.9% identity in 251 aa overlap). Also weakly similar to others e.g. Q9HWX2|RIBD|PA4056 riboflavin-specific deaminase/reductase from Pseudomonas aeruginosa (373 aa), FASTA scores: opt: 211, E(): 6.3e-06, (30.1% identity in 216 aa overlap); Q9HQA1|RIBG|VNG1256G riboflavin-specific deaminase from Halobacterium sp. strain NRC-1 (220 aa), FASTA scores: opt: 202, E(): 1.5e-05, (27.0% identity in 174 aa overlap); O28272|RIB7_ARCFU|AF2007 putative 5-amino-6-(5-phosphoribosylamino)uracil reductase (HTP reductase) from Archaeoglobus fulgidus (219 aa), FASTA scores: opt: 209, E(): 5.4e-06, (24.15% identity in 211 aa overlap); P25539|RIBD_ECOLI|RIBG|B0414 from Escherichia coli strain K12 (367 aa), FASTA scores: opt: 185, E(): 0.00026, (26.7% identity in 221 aa overlap); etc. But also similar to several hydrolases e.g. Q9X825|SC9B1.05 putative hydrolase from Streptomyces coelicolor (265 aa), FASTA scores: opt: 536, E(): 2.9e-26, (44.25% identity in 235 aa overlap); Q9RKM1|SCD17.10 putative bifunctional enzyme deaminase/reductase from Streptomyces coelicolor (376 aa), FASTA scores: opt: 228, E(): 5.6e-07, (33.5% identity in 188 aa overlap); etc. Equivalent to AAK47060 from Mycobacterium tuberculosis strain CDC1551 (239 aa) but longer 19 aa. Supposed belong to the cytidine and deoxycytidylate deaminases family in the N-terminal section; and to the HTP reductase family in the C-terminal section. |
| Functional category | Intermediary metabolism and respiration |
| Proteomics | Identified in the cytosol of M. tuberculosis H37Rv using 2DLC/MS (See Mawuenyega et al., 2005). Identified by mass spectrometry in Triton X-114 extracts of M. tuberculosis H37Rv (See Malen et al., 2010). Identified by mass spectrometry in M. tuberculosis H37Rv-infected guinea pig lungs at 30 days but not 90 days (See Kruh et al., 2010). Identified by mass spectrometry in the membrane protein fraction and whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate (See de Souza et al., 2011). Translational start site supported by proteomics data (See de Souza et al., 2011). |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv and CDC1551 strains (see Sassetti et al., 2003 and Lamichhane et al., 2003). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 2986839 | 2987615 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv2671|ribD
MPDSGQLGAADTPLRLLSSVHYLTDGELPQLYDYPDDGTWLRANFISSLDGGATVDGTSGAMAGPGDRFVFNLLRELADVIVVGVGTVRIEGYSGVRMGVVQRQHRQARGQSEVPQLAIVTRSGRLDRDMAVFTRTEMAPLVLTTTAVADDTRQRLAGLAEVIACSGDDPGTVDEAVLVSQLAARGLRRILTEGGPTLLGTFVERDVLDELCLTIAPYVVGGLARRIVTGPGQVLTRMRCAHVLTDDSGYLYTRYVKT
Bibliography
- Lamichhane G et al. [2003]. A postgenomic method for predicting essential genes at subsaturation levels of mutagenesis: application to Mycobacterium tuberculosis. Mutant
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Mawuenyega KG et al. [2005]. Mycobacterium tuberculosis functional network analysis by global subcellular protein profiling. Proteomics
- Målen H et al. [2010]. Definition of novel cell envelope associated proteins in Triton X-114 extracts of Mycobacterium tuberculosis H37Rv. Proteomics
- Kruh NA et al. [2010]. Portrait of a pathogen: the Mycobacterium tuberculosis proteome in vivo. Proteomics
- de Souza GA et al. [2011]. Bacterial proteins with cleaved or uncleaved signal peptides of the general secretory pathway. Proteomics
- de Souza GA et al. [2011]. Proteogenomic analysis of polymorphisms and gene annotation divergences in prokaryotes using a clustered mass spectrometry-friendly database. Proteomics Sequence
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant
