Go to browser
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionInvolved in regulation of nucleotide excision repair and sos response. Represses a number of genes involved in the response to DNA damage (sos response), including RECA and LEXA. Has been shown to bind to the 14 bp palindromic sequence 5'-cgaacnnnngttcg-3'. In the presence of single-stranded DNA, RECA interacts with LEXA causing an autocatalytic cleavage which disrupts the DNA-binding part of LEXA, leading to derepression of the sos regulon and eventually DNA repair [catalytic activity: hydrolysis of ala-|-GLY bond in repressor LEXA].
ProductRepressor LexA
CommentsRv2720, (MTCY05A6.41), len: 236 aa. LexA repressor (see citations below), equivalent to Q49848|LEXA_MYCLE|ML1003|B2235_F2_55 LEXA repressor from Mycobacterium leprae (217 aa), FASTA scores: opt: 1255, E(): 7.1e-70, (89.8% identity in 216 aa overlap). Also highly similar to others e.g. O69979|LEXA_STRCO|SC4H2.24c from Streptomyces coelicolor (234 aa), FASTA scores: opt: 1034, E(): 2.6e-56, (70.5% identity in 217 aa overlap); O86847|LEXA_STRCL from Streptomyces clavuligerus (239 aa), FASTA scores: opt: 1021, E(): 1.6e-55, (69.1% identity in 217 aa overlap); Q9KAD3|LEXA_BACHD from Bacillus halodurans (207 aa), FASTA scores: opt: 645, E(): 1.5e-32, (47.9% identity in 213 aa overlap); etc. Belongs to peptidase family S24; also known as the UMUD/LEXA family. Start changed since first submission (+19 aa).
Functional categoryRegulatory proteins
ProteomicsIdentified by mass spectrometry in Triton X-114 extracts of M. tuberculosis H37Rv (See Malen et al., 2010). Identified by mass spectrometry in the membrane protein fraction and whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate (See de Souza et al., 2011). Translational start site supported by proteomics data (See Kelkar et al., 2011).
TranscriptomicsmRNA identified by Microarray analysis (see citations below).
MutantEssential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Disruption of this gene results in growth defect of H37Rv in vitro, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS30317883032498+
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv2720|lexA
MNDSNDTSVAGGAAGADSRVLSADSALTERQRTILDVIRASVTSRGYPPSIREIGDAVGLTSTSSVAHQLRTLERKGYLRRDPNRPRAVNVRGADDAALPPVTEVAGSDALPEPTFVPVLGRIAAGGPILAEEAVEDVFPLPRELVGEGTLFLLKVIGDSMVEAAICDGDWVVVRQQNVADNGDIVAAMIDGEATVKTFKRAGGQVWLMPHNPAFDPIPGNDATVLGKVVTVIRKV
      
Bibliography