Gene Rv2720
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Involved in regulation of nucleotide excision repair and sos response. Represses a number of genes involved in the response to DNA damage (sos response), including RECA and LEXA. Has been shown to bind to the 14 bp palindromic sequence 5'-cgaacnnnngttcg-3'. In the presence of single-stranded DNA, RECA interacts with LEXA causing an autocatalytic cleavage which disrupts the DNA-binding part of LEXA, leading to derepression of the sos regulon and eventually DNA repair [catalytic activity: hydrolysis of ala-|-GLY bond in repressor LEXA]. |
| Product | Repressor LexA |
| Comments | Rv2720, (MTCY05A6.41), len: 236 aa. LexA repressor (see citations below), equivalent to Q49848|LEXA_MYCLE|ML1003|B2235_F2_55 LEXA repressor from Mycobacterium leprae (217 aa), FASTA scores: opt: 1255, E(): 7.1e-70, (89.8% identity in 216 aa overlap). Also highly similar to others e.g. O69979|LEXA_STRCO|SC4H2.24c from Streptomyces coelicolor (234 aa), FASTA scores: opt: 1034, E(): 2.6e-56, (70.5% identity in 217 aa overlap); O86847|LEXA_STRCL from Streptomyces clavuligerus (239 aa), FASTA scores: opt: 1021, E(): 1.6e-55, (69.1% identity in 217 aa overlap); Q9KAD3|LEXA_BACHD from Bacillus halodurans (207 aa), FASTA scores: opt: 645, E(): 1.5e-32, (47.9% identity in 213 aa overlap); etc. Belongs to peptidase family S24; also known as the UMUD/LEXA family. Start changed since first submission (+19 aa). |
| Functional category | Regulatory proteins |
| Proteomics | Identified by mass spectrometry in Triton X-114 extracts of M. tuberculosis H37Rv (See Malen et al., 2010). Identified by mass spectrometry in the membrane protein fraction and whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate (See de Souza et al., 2011). Translational start site supported by proteomics data (See Kelkar et al., 2011). |
| Transcriptomics | mRNA identified by Microarray analysis (see citations below). |
| Mutant | Essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Disruption of this gene results in growth defect of H37Rv in vitro, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 3031788 | 3032498 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv2720|lexA
MNDSNDTSVAGGAAGADSRVLSADSALTERQRTILDVIRASVTSRGYPPSIREIGDAVGLTSTSSVAHQLRTLERKGYLRRDPNRPRAVNVRGADDAALPPVTEVAGSDALPEPTFVPVLGRIAAGGPILAEEAVEDVFPLPRELVGEGTLFLLKVIGDSMVEAAICDGDWVVVRQQNVADNGDIVAAMIDGEATVKTFKRAGGQVWLMPHNPAFDPIPGNDATVLGKVVTVIRKV
Bibliography
- Movahedzadeh F et al. [1997]. Characterization of Mycobacterium tuberculosis LexA: recognition of a Cheo (Bacillus-type SOS) box. Sequence Product
- Movahedzadeh F et al. [1997]. Determination of DNA sequences required for regulated Mycobacterium tuberculosis RecA expression in response to DNA-damaging agents suggests that two modes of regulation exist. Regulation
- Mizrahi V et al. [1998]. DNA repair in Mycobacterium tuberculosis. What have we learnt from the genome sequence? Secondary Function
- Brooks PC, Movahedzadeh F and Davis EO [2001]. Identification of some DNA damage-inducible genes of Mycobacterium tuberculosis: apparent lack of correlation with LexA binding. Function
- Davis EO et al. [2002]. Definition of the mycobacterial SOS box and use to identify LexA-regulated genes in Mycobacterium tuberculosis. Sequence Regulation Transcriptome
- Dullaghan EM et al. [2002]. The role of multiple SOS boxes upstream of the Mycobacterium tuberculosis lexA gene--identification of a novel DNA-damage-inducible gene. Mutant Regulation Secondary
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Lee JH et al. [2008]. Role of stress response sigma factor SigG in Mycobacterium tuberculosis. Regulon
- Smollett KL et al. [2009]. Experimental determination of translational start sites resolves uncertainties in genomic open reading frame predictions - application to Mycobacterium tuberculosis. Proteomics
- MÃ¥len H et al. [2010]. Definition of novel cell envelope associated proteins in Triton X-114 extracts of Mycobacterium tuberculosis H37Rv. Proteomics
- de Souza GA et al. [2011]. Bacterial proteins with cleaved or uncleaved signal peptides of the general secretory pathway. Proteomics
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- Kelkar DS et al. [2011]. Proteogenomic analysis of Mycobacterium tuberculosis by high resolution mass spectrometry. Proteomics Sequence
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant