Go to browser
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionThe sigma factor is an initiation factor that promotes attachment of the RNA polymerase to specific initiation sites and then is released. Thought to be involved in survival and proliferation in lung granulomas during infection. Thought to be involved in virulence and persistence processes. Modulates expression of the 16 KDa alpha-crystallin homologue/Rv2031c. Negatively regulated by Rv3287c|RSBW|USFX.
ProductAlternative RNA polymerase sigma factor SigF
CommentsRv3286c, (MTCY71.26), len: 261 aa. SigF, stress response/stationary phase RNA polymerase sigma factor (see citations below), similar to several Streptomyces RNA polymerase sigma factors e.g. Q9RPC8|sigh from Streptomyces coelicolor A3(2) (354 aa), FASTA scores: opt: 869, E(): 1.1e-45, (51.15% identity in 258 aa overlap); Q9RIT0|SIG1 from Streptomyces coelicolor (361 aa), FASTA scores: opt: 869, E(): 1.1e-45, (51.15% identity in 258 aa overlap); Q9ADM4|2SC10A7.38c from Streptomyces coelicolor (318 aa), FASTA scores: opt: 776, E(): 4.6e-40, (48.75% identity in 240 aa overlap); P37971|RPOF_STRCO|SIGF|RPOX|2SCD60.01c from Streptomyces coelicolor (287 aa), FASTA scores: opt: 717, E(): 1.6e-36, (44.5% identity in 245 aa overlap); P37970|RPOF_STRAU|SIGF|RPOX from Streptomyces aureofaciens (297 aa); etc. Contains possible helix-turn-helix motif at aa 229-250 (+7.38 SD). Similar to the sigma-70 factor family. Seems expressed in stationary phase and under stress conditions in vitro (see citations below).
Functional categoryInformation pathways
TranscriptomicsmRNA identified by SCOTS method, during infection of cultured human primary macrophages (see Graham & Clark-Curtiss 1999). mRNA also identified by real-time quantitative RT-PCR during exponential growing cultures (see Manganelli et al., 1999). And mRNA identified by microarray analysis and up-regulated after 96h of starvation (see Betts et al., 2002).
MutantNon-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Disruption of this gene provides a growth advantage for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS36681693668954-
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv3286c|sigF
VTARAAGGSASRANEYADVPEMFRELVGLPAGSPEFQRHRDKIVQRCLPLADHIARRFEGRGEPRDDLIQVARVGLVNAAVRFDVKTGSDFVSFAVPTIMGEVRRHFRDNSWSVKVPRRLKELHLRLGTATADLSQRLGRAPSASELAAELGMDRAEVIEGLLAGSSYHTLSIDSGGGSDDDARAITDTLGDVDAGLDQIENREVLRPLLEALPERERTVLVLRFFDSMTQTQIAERVGISQMHVSRLLAKSLARLRDQLE
      
Bibliography