Gene Rv3286c
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | The sigma factor is an initiation factor that promotes attachment of the RNA polymerase to specific initiation sites and then is released. Thought to be involved in survival and proliferation in lung granulomas during infection. Thought to be involved in virulence and persistence processes. Modulates expression of the 16 KDa alpha-crystallin homologue/Rv2031c. Negatively regulated by Rv3287c|RSBW|USFX. |
| Product | Alternative RNA polymerase sigma factor SigF |
| Comments | Rv3286c, (MTCY71.26), len: 261 aa. SigF, stress response/stationary phase RNA polymerase sigma factor (see citations below), similar to several Streptomyces RNA polymerase sigma factors e.g. Q9RPC8|sigh from Streptomyces coelicolor A3(2) (354 aa), FASTA scores: opt: 869, E(): 1.1e-45, (51.15% identity in 258 aa overlap); Q9RIT0|SIG1 from Streptomyces coelicolor (361 aa), FASTA scores: opt: 869, E(): 1.1e-45, (51.15% identity in 258 aa overlap); Q9ADM4|2SC10A7.38c from Streptomyces coelicolor (318 aa), FASTA scores: opt: 776, E(): 4.6e-40, (48.75% identity in 240 aa overlap); P37971|RPOF_STRCO|SIGF|RPOX|2SCD60.01c from Streptomyces coelicolor (287 aa), FASTA scores: opt: 717, E(): 1.6e-36, (44.5% identity in 245 aa overlap); P37970|RPOF_STRAU|SIGF|RPOX from Streptomyces aureofaciens (297 aa); etc. Contains possible helix-turn-helix motif at aa 229-250 (+7.38 SD). Similar to the sigma-70 factor family. Seems expressed in stationary phase and under stress conditions in vitro (see citations below). |
| Functional category | Information pathways |
| Transcriptomics | mRNA identified by SCOTS method, during infection of cultured human primary macrophages (see Graham & Clark-Curtiss 1999). mRNA also identified by real-time quantitative RT-PCR during exponential growing cultures (see Manganelli et al., 1999). And mRNA identified by microarray analysis and up-regulated after 96h of starvation (see Betts et al., 2002). |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Disruption of this gene provides a growth advantage for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 3668169 | 3668954 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv3286c|sigF
VTARAAGGSASRANEYADVPEMFRELVGLPAGSPEFQRHRDKIVQRCLPLADHIARRFEGRGEPRDDLIQVARVGLVNAAVRFDVKTGSDFVSFAVPTIMGEVRRHFRDNSWSVKVPRRLKELHLRLGTATADLSQRLGRAPSASELAAELGMDRAEVIEGLLAGSSYHTLSIDSGGGSDDDARAITDTLGDVDAGLDQIENREVLRPLLEALPERERTVLVLRFFDSMTQTQIAERVGISQMHVSRLLAKSLARLRDQLE
Bibliography
- DeMaio J et al. [1996]. A stationary-phase stress-response sigma factor from Mycobacterium tuberculosis. Sequence
- Yuan Y et al. [1996]. Stationary phase-associated protein expression in Mycobacterium tuberculosis: function of the mycobacterial alpha-crystallin homolog. Secondary Regulation
- Gomez JE et al. [1997]. Sigma factors of Mycobacterium tuberculosis. Review
- DeMaio J et al. [1997]. Mycobacterium tuberculosis sigF is part of a gene cluster with similarities to the Bacillus subtilis sigF and sigB operons. Secondary
- Graham JE and Clark-Curtiss JE [1999]. Identification of Mycobacterium tuberculosis RNAs synthesized in response to phagocytosis by human macrophages by selective capture of transcribed sequences (SCOTS). Transcriptome
- Manganelli R et al. [1999]. Differential expression of 10 sigma factor genes in Mycobacterium tuberculosis. Transcriptome
- Manabe YC et al. [1999]. Conditional sigma factor expression, using the inducible acetamidase promoter, reveals that the Mycobacterium tuberculosis sigF gene modulates expression of the 16-kilodalton alpha-crystallin homologue. Regulation
- Michele TM et al. [1999]. Exposure to antibiotics induces expression of the Mycobacterium tuberculosis sigF gene: implications for chemotherapy against mycobacterial persistors. Regulation
- Chen P et al. [2000]. Construction and characterization of a Mycobacterium tuberculosis mutant lacking the alternate sigma factor gene, sigF. Mutant
- Chen P, Gomez J and Bishai WR [2000]. Review
- Beaucher J et al. [2002]. Novel Mycobacterium tuberculosis anti-sigma factor antagonists control sigmaF activity by distinct mechanisms. Product Function Regulation Mutant
- Betts JC et al. [2002]. Evaluation of a nutrient starvation model of Mycobacterium tuberculosis persistence by gene and protein expression profiling. Transcriptome
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Parida BK et al. [2005]. Interactions of anti-sigma factor antagonists of Mycobacterium tuberculosis in the yeast two-hybrid system. Biochemistry
- Rodrigue S et al. [2007]. Identification of mycobacterial sigma factor binding sites by chromatin immunoprecipitation assays. Regulon
- Lee JH et al. [2008]. Roles of SigB and SigF in the Mycobacterium tuberculosis sigma factor network. Regulon
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant